Anti ARID4B pAb (ATL-HPA027205)

Atlas Antibodies

Catalog No.:
ATL-HPA027205-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: AT-rich interaction domain 4B
Gene Name: ARID4B
Alternative Gene Name: BCAA, BRCAA1, RBP1L1, SAP180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039219: 91%, ENSRNOG00000016391: 90%
Entrez Gene ID: 51742
Uniprot ID: Q4LE39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NCKLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQEDERGAQDM
Gene Sequence NCKLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQEDERGAQDM
Gene ID - Mouse ENSMUSG00000039219
Gene ID - Rat ENSRNOG00000016391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARID4B pAb (ATL-HPA027205)
Datasheet Anti ARID4B pAb (ATL-HPA027205) Datasheet (External Link)
Vendor Page Anti ARID4B pAb (ATL-HPA027205) at Atlas Antibodies

Documents & Links for Anti ARID4B pAb (ATL-HPA027205)
Datasheet Anti ARID4B pAb (ATL-HPA027205) Datasheet (External Link)
Vendor Page Anti ARID4B pAb (ATL-HPA027205)