Anti ARID2 pAb (ATL-HPA063044)

Atlas Antibodies

Catalog No.:
ATL-HPA063044-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: AT rich interactive domain 2 (ARID, RFX-like)
Gene Name: ARID2
Alternative Gene Name: BAF200, DKFZp686G052, FLJ30619, KIAA1557
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033237: 86%, ENSRNOG00000004831: 86%
Entrez Gene ID: 196528
Uniprot ID: Q68CP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDITQQDTAKGD
Gene Sequence NGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDITQQDTAKGD
Gene ID - Mouse ENSMUSG00000033237
Gene ID - Rat ENSRNOG00000004831
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARID2 pAb (ATL-HPA063044)
Datasheet Anti ARID2 pAb (ATL-HPA063044) Datasheet (External Link)
Vendor Page Anti ARID2 pAb (ATL-HPA063044) at Atlas Antibodies

Documents & Links for Anti ARID2 pAb (ATL-HPA063044)
Datasheet Anti ARID2 pAb (ATL-HPA063044) Datasheet (External Link)
Vendor Page Anti ARID2 pAb (ATL-HPA063044)