Anti ARID1B pAb (ATL-HPA016511)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016511-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARID1B
Alternative Gene Name: 6A3-5, BAF250b, DAN15, ELD/OSA1, KIAA1235, p250R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069729: 94%, ENSRNOG00000017030: 93%
Entrez Gene ID: 57492
Uniprot ID: Q8NFD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR |
| Gene Sequence | SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR |
| Gene ID - Mouse | ENSMUSG00000069729 |
| Gene ID - Rat | ENSRNOG00000017030 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARID1B pAb (ATL-HPA016511) | |
| Datasheet | Anti ARID1B pAb (ATL-HPA016511) Datasheet (External Link) |
| Vendor Page | Anti ARID1B pAb (ATL-HPA016511) at Atlas Antibodies |
| Documents & Links for Anti ARID1B pAb (ATL-HPA016511) | |
| Datasheet | Anti ARID1B pAb (ATL-HPA016511) Datasheet (External Link) |
| Vendor Page | Anti ARID1B pAb (ATL-HPA016511) |