Anti ARID1B pAb (ATL-HPA016511)

Atlas Antibodies

SKU:
ATL-HPA016511-25
  • Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: AT rich interactive domain 1B (SWI1-like)
Gene Name: ARID1B
Alternative Gene Name: 6A3-5, BAF250b, DAN15, ELD/OSA1, KIAA1235, p250R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069729: 94%, ENSRNOG00000017030: 93%
Entrez Gene ID: 57492
Uniprot ID: Q8NFD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR
Gene Sequence SQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSR
Gene ID - Mouse ENSMUSG00000069729
Gene ID - Rat ENSRNOG00000017030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARID1B pAb (ATL-HPA016511)
Datasheet Anti ARID1B pAb (ATL-HPA016511) Datasheet (External Link)
Vendor Page Anti ARID1B pAb (ATL-HPA016511) at Atlas Antibodies

Documents & Links for Anti ARID1B pAb (ATL-HPA016511)
Datasheet Anti ARID1B pAb (ATL-HPA016511) Datasheet (External Link)
Vendor Page Anti ARID1B pAb (ATL-HPA016511)