Anti ARID1A pAb (ATL-HPA005456)
Atlas Antibodies
- SKU:
- ATL-HPA005456-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ARID1A
Alternative Gene Name: B120, BAF250, BAF250a, C10rf4, C1orf4, P270, SMARCF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007880: 95%, ENSRNOG00000006137: 88%
Entrez Gene ID: 8289
Uniprot ID: O14497
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK |
Gene Sequence | PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK |
Gene ID - Mouse | ENSMUSG00000007880 |
Gene ID - Rat | ENSRNOG00000006137 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARID1A pAb (ATL-HPA005456) | |
Datasheet | Anti ARID1A pAb (ATL-HPA005456) Datasheet (External Link) |
Vendor Page | Anti ARID1A pAb (ATL-HPA005456) at Atlas Antibodies |
Documents & Links for Anti ARID1A pAb (ATL-HPA005456) | |
Datasheet | Anti ARID1A pAb (ATL-HPA005456) Datasheet (External Link) |
Vendor Page | Anti ARID1A pAb (ATL-HPA005456) |
Citations for Anti ARID1A pAb (ATL-HPA005456) – 71 Found |
Weigert, Oliver; Kopp, Nadja; Lane, Andrew A; Yoda, Akinori; Dahlberg, Suzanne E; Neuberg, Donna; Bahar, Anita Y; Chapuy, Bjoern; Kutok, Jeffery L; Longtine, Janina A; Kuo, Frank C; Haley, Terry; Salois, Maura; Sullivan, Timothy J; Fisher, David C; Fox, Edward A; Rodig, Scott J; Antin, Joseph H; Weinstock, David M. Molecular ontogeny of donor-derived follicular lymphomas occurring after hematopoietic cell transplantation. Cancer Discovery. 2012;2(1):47-55. PubMed |
Bitler, Benjamin G; Aird, Katherine M; Garipov, Azat; Li, Hua; Amatangelo, Michael; Kossenkov, Andrew V; Schultz, David C; Liu, Qin; Shih, Ie-Ming; Conejo-Garcia, Jose R; Speicher, David W; Zhang, Rugang. Synthetic lethality by targeting EZH2 methyltransferase activity in ARID1A-mutated cancers. Nature Medicine. 2015;21(3):231-8. PubMed |
Faraj, Sheila F; Chaux, Alcides; Gonzalez-Roibon, Nilda; Munari, Enrico; Cubilla, Antonio L; Shih, Ie-Ming; Netto, George J. Immunohistochemical expression of ARID1A in penile squamous cell carcinomas: a tissue microarray study of 112 cases. Human Pathology. 2015;46(5):761-6. PubMed |
Suryo Rahmanto, Yohan; Jung, Jin-Gyoung; Wu, Ren-Chin; Kobayashi, Yusuke; Heaphy, Christopher M; Meeker, Alan K; Wang, Tian-Li; Shih, Ie-Ming. Inactivating ARID1A Tumor Suppressor Enhances TERT Transcription and Maintains Telomere Length in Cancer Cells. The Journal Of Biological Chemistry. 2016;291(18):9690-9. PubMed |
Lee, Lik Hang; Sadot, Eran; Ivelja, Sinisa; Vakiani, Efsevia; Hechtman, Jaclyn F; Sevinsky, Christopher J; Klimstra, David S; Ginty, Fiona; Shia, Jinru. ARID1A expression in early stage colorectal adenocarcinoma: an exploration of its prognostic significance. Human Pathology. 2016;53( 26980037):97-104. PubMed |
Sun, Xuxu; Chuang, Jen-Chieh; Kanchwala, Mohammed; Wu, Linwei; Celen, Cemre; Li, Lin; Liang, Hanquan; Zhang, Shuyuan; Maples, Thomas; Nguyen, Liem H; Wang, Sam C; Signer, Robert A J; Sorouri, Mahsa; Nassour, Ibrahim; Liu, Xin; Xu, Jian; Wu, Meng; Zhao, Yong; Kuo, Yi-Chun; Wang, Zhong; Xing, Chao; Zhu, Hao. Suppression of the SWI/SNF Component Arid1a Promotes Mammalian Regeneration. Cell Stem Cell. 2016;18(4):456-66. PubMed |
Rosa-Rosa, Juan M; Leskelä, Susanna; Cristóbal-Lana, Eva; Santón, Almudena; López-García, Ma Ángeles; Muñoz, Gloria; Pérez-Mies, Belen; Biscuola, Michele; Prat, Jaime; Esther, Oliva; Soslow, Robert A; Matias-Guiu, Xavier; Palacios, Jose. Molecular genetic heterogeneity in undifferentiated endometrial carcinomas. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2016;29(11):1390-1398. PubMed |
Ayhan, Ayse; Mao, Tsui-Lien; Suryo Rahmanto, Yohan; Zeppernick, Felix; Ogawa, Hiroshi; Wu, Ren-Chin; Wang, Tian-Li; Shih, Ie-Ming. Increased proliferation in atypical hyperplasia/endometrioid intraepithelial neoplasia of the endometrium with concurrent inactivation of ARID1A and PTEN tumour suppressors. The Journal Of Pathology. Clinical Research. 2015;1(3):186-93. PubMed |
Llorca-Cardeñosa, Marta Jessica; Fleitas, Tania; Ibarrola-Villava, Maider; Peña-Chilet, María; Mongort, Cristina; Martinez-Ciarpaglini, Carolina; Navarro, Lara; Gambardella, Valentina; Castillo, Josefa; Roselló, Susana; Navarro, Samuel; Ribas, Gloria; Cervantes, Andrés. Epigenetic changes in localized gastric cancer: the role of RUNX3 in tumor progression and the immune microenvironment. Oncotarget. 2016;7(39):63424-63436. PubMed |
Valtcheva, Nadejda; Lang, Franziska M; Noske, Aurelia; Samartzis, Eleftherios P; Schmidt, Anna-Maria; Bellini, Elisa; Fink, Daniel; Moch, Holger; Rechsteiner, Markus; Dedes, Konstantin J; Wild, Peter J. Tracking the origin of simultaneous endometrial and ovarian cancer by next-generation sequencing - a case report. Bmc Cancer. 2017;17(1):66. PubMed |
Walter, David M; Venancio, Olivia S; Buza, Elizabeth L; Tobias, John W; Deshpande, Charuhas; Gudiel, A Andrea; Kim-Kiselak, Caroline; Cicchini, Michelle; Yates, Travis J; Feldser, David M. Systematic In Vivo Inactivation of Chromatin-Regulating Enzymes Identifies Setd2 as a Potent Tumor Suppressor in Lung Adenocarcinoma. Cancer Research. 2017;77(7):1719-1729. PubMed |
Howitt, Brooke E; Strickland, Kyle C; Sholl, Lynette M; Rodig, Scott; Ritterhouse, Lauren L; Chowdhury, Dipanjan; D'Andrea, Alan D; Matulonis, Ursula A; Konstantinopoulos, Panagiotis A. Clear cell ovarian cancers with microsatellite instability: A unique subset of ovarian cancers with increased tumor-infiltrating lymphocytes and PD-1/PD-L1 expression. Oncoimmunology. 6(2):e1277308. PubMed |
Nastase, Anca; Teo, Jin Yao; Heng, Hong Lee; Ng, Cedric Chuan Young; Myint, Swe Swe; Rajasegaran, Vikneswari; Loh, Jia Liang; Lee, Ser Yee; Ooi, London Lucien; Chung, Alexander Yaw Fui; Chow, Pierce Kah Hoe; Cheow, Peng Chung; Wan, Wei Keat; Azhar, Rafy; Khoo, Avery; Xiu, Sam Xin; Alkaff, Syed Muhammad Fahmy; Cutcutache, Ioana; Lim, Jing Quan; Ong, Choon Kiat; Herlea, Vlad; Dima, Simona; Duda, Dan G; Teh, Bin Tean; Popescu, Irinel; Lim, Tony Kiat Hon. Genomic and proteomic characterization of ARID1A chromatin remodeller in ampullary tumors. American Journal Of Cancer Research. 7(3):484-502. PubMed |
Jiang, Wei; Dulaimi, Essel; Devarajan, Karthik; Parsons, Theodore; Wang, Qiong; O'Neill, Raymond; Solomides, Charalambos; Peiper, Stephen C; Testa, Joseph R; Uzzo, Robert; Yang, Haifeng. Intratumoral heterogeneity analysis reveals hidden associations between protein expression losses and patient survival in clear cell renal cell carcinoma. Oncotarget. 2017;8(23):37423-37434. PubMed |
Visser, Nicole C M; van der Wurff, Anneke A M; Pijnenborg, Johanna M A; Massuger, Leon F A G; Bulten, Johan; Nagtegaal, Iris D. Tissue microarray is suitable for scientific biomarkers studies in endometrial cancer. Virchows Archiv : An International Journal Of Pathology. 2018;472(3):407-413. PubMed |
Shahid, Muhammad; Gull, Nicole; Yeon, Austin; Cho, Eunho; Bae, Jooeun; Yoon, Hyun Seok; You, Sungyong; Yoon, Hana; Kim, Minjung; Berman, Benjamin P; Kim, Jayoung. Alpha-oxoglutarate inhibits the proliferation of immortalized normal bladder epithelial cells via an epigenetic switch involving ARID1A. Scientific Reports. 2018;8(1):4505. PubMed |
Khalique, Saira; Naidoo, Kalnisha; Attygalle, Ayoma D; Kriplani, Divya; Daley, Frances; Lowe, Anne; Campbell, James; Jones, Thomas; Hubank, Michael; Fenwick, Kerry; Matthews, Nicholas; Rust, Alistair G; Lord, Christopher J; Banerjee, Susana; Natrajan, Rachael. Optimised ARID1A immunohistochemistry is an accurate predictor of ARID1A mutational status in gynaecological cancers. The Journal Of Pathology. Clinical Research. 2018;4(3):154-166. PubMed |
Berns, Katrien; Caumanns, Joseph J; Hijmans, E Marielle; Gennissen, Annemiek M C; Severson, Tesa M; Evers, Bastiaan; Wisman, G Bea A; Jan Meersma, Gert; Lieftink, Cor; Beijersbergen, Roderick L; Itamochi, Hiroaki; van der Zee, Ate G J; de Jong, Steven; Bernards, René. ARID1A mutation sensitizes most ovarian clear cell carcinomas to BET inhibitors. Oncogene. 2018;37(33):4611-4625. PubMed |
Zhou, Huan; Tan, Shun; Li, Hong; Lin, Xiangtao. Expression and significance of EBV, ARID1A and PIK3CA in gastric carcinoma. Molecular Medicine Reports. 2019;19(3):2125-2136. PubMed |
Lindén, Malin; Thomsen, Christer; Grundevik, Pernilla; Jonasson, Emma; Andersson, Daniel; Runnberg, Rikard; Dolatabadi, Soheila; Vannas, Christoffer; Luna Santamarίa, Manuel; Fagman, Henrik; Ståhlberg, Anders; Åman, Pierre. FET family fusion oncoproteins target the SWI/SNF chromatin remodeling complex. Embo Reports. 2019;20(5) PubMed |
Ünçel, Melek; Diniz, Gülden; Aköz, Gamze; Ekin, Zübeyde Yıldırım; Sayhan, Sevil; Yardım, Serdar; Salimoğlu, Semra. Loss of Nuclear ARID-1A Expressions Is Associated with Hormone Receptor Status in Breast Cancers. European Journal Of Breast Health. 2019;15(2):125-129. PubMed |
Wang, Zixi; Chen, Kenian; Jia, Yuemeng; Chuang, Jen-Chieh; Sun, Xuxu; Lin, Yu-Hsuan; Celen, Cemre; Li, Lin; Huang, Fang; Liu, Xin; Castrillon, Diego H; Wang, Tao; Zhu, Hao. Dual ARID1A/ARID1B loss leads to rapid carcinogenesis and disruptive redistribution of BAF complexes. Nature Cancer. 2020;1(9):909-922. PubMed |
Liu, Xiao; Dai, Shang-Kun; Liu, Pei-Pei; Liu, Chang-Mei. Arid1a regulates neural stem/progenitor cell proliferation and differentiation during cortical development. Cell Proliferation. 2021;54(11):e13124. PubMed |
Blümli, Seraina; Wiechens, Nicola; Wu, Meng-Ying; Singh, Vijender; Gierlinski, Marek; Schweikert, Gabriele; Gilbert, Nick; Naughton, Catherine; Sundaramoorthy, Ramasubramanian; Varghese, Joby; Gourlay, Robert; Soares, Renata; Clark, David; Owen-Hughes, Tom. Acute depletion of the ARID1A subunit of SWI/SNF complexes reveals distinct pathways for activation and repression of transcription. Cell Reports. 2021;37(5):109943. PubMed |
Wang, Tao; Guo, Jinyan; Liu, Wenhua; Guo, Qi; Cheng, Lvhuan; Zheng, Renshan; Hu, Xinchun. Downregulation of ARID1A is correlated with poor prognosis in non-small cell lung cancer. Translational Cancer Research. 2020;9(8):4896-4905. PubMed |
Hamilton, Sarah Nicole; Tinker, Anna V; Kwon, Janice; Lim, Peter; Kong, Iwa; Sihra, Sona; Koebel, Martin; Lee, Cheng Han. Treatment and outcomes in undifferentiated and dedifferentiated endometrial carcinoma. Journal Of Gynecologic Oncology. 2022;33(3):e25. PubMed |
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
Guan, Bin; Mao, Tsui-Lien; Panuganti, Pradeep K; Kuhn, Elisabetta; Kurman, Robert J; Maeda, Daichi; Chen, Elizabeth; Jeng, Yung-Ming; Wang, Tian-Li; Shih, Ie-Ming. Mutation and loss of expression of ARID1A in uterine low-grade endometrioid carcinoma. The American Journal Of Surgical Pathology. 2011;35(5):625-32. PubMed |
Wang, Kai; Kan, Junsuo; Yuen, Siu Tsan; Shi, Stephanie T; Chu, Kent Man; Law, Simon; Chan, Tsun Leung; Kan, Zhengyan; Chan, Annie S Y; Tsui, Wai Yin; Lee, Siu Po; Ho, Siu Lun; Chan, Anthony K W; Cheng, Grace H W; Roberts, Peter C; Rejto, Paul A; Gibson, Neil W; Pocalyko, David J; Mao, Mao; Xu, Jiangchun; Leung, Suet Yi. Exome sequencing identifies frequent mutation of ARID1A in molecular subtypes of gastric cancer. Nature Genetics. 2011;43(12):1219-23. PubMed |
Yamamoto, Sohei; Tsuda, Hitoshi; Takano, Masashi; Tamai, Seiichi; Matsubara, Osamu. PIK3CA mutations and loss of ARID1A protein expression are early events in the development of cystic ovarian clear cell adenocarcinoma. Virchows Archiv : An International Journal Of Pathology. 2012;460(1):77-87. PubMed |
Yamamoto, Sohei; Tsuda, Hitoshi; Takano, Masashi; Tamai, Seiichi; Matsubara, Osamu. Loss of ARID1A protein expression occurs as an early event in ovarian clear-cell carcinoma development and frequently coexists with PIK3CA mutations. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2012;25(4):615-24. PubMed |
Wu, Chen Hsuan; Mao, Tsui-Lien; Vang, Russell; Ayhan, Ayse; Wang, Tian-Li; Kurman, Robert J; Shih, Ie-Ming. Endocervical-type mucinous borderline tumors are related to endometrioid tumors based on mutation and loss of expression of ARID1A. International Journal Of Gynecological Pathology : Official Journal Of The International Society Of Gynecological Pathologists. 2012;31(4):297-303. PubMed |
Ayhan, Ayse; Mao, Tsui-Lien; Seckin, Tamer; Wu, Chen-Hsuan; Guan, Bin; Ogawa, Hiroshi; Futagami, Masayuki; Mizukami, Hiroki; Yokoyama, Yoshihito; Kurman, Robert J; Shih, Ie-Ming. Loss of ARID1A expression is an early molecular event in tumor progression from ovarian endometriotic cyst to clear cell and endometrioid carcinoma. International Journal Of Gynecological Cancer : Official Journal Of The International Gynecological Cancer Society. 2012;22(8):1310-5. PubMed |
Xiao, Wenbin; Awadallah, Amad; Xin, Wei. Loss of ARID1A/BAF250a expression in ovarian endometriosis and clear cell carcinoma. International Journal Of Clinical And Experimental Pathology. 5(7):642-50. PubMed |
Guan, Bin; Gao, Min; Wu, Chen-Hsuan; Wang, Tian-Li; Shih, Ie-Ming. Functional analysis of in-frame indel ARID1A mutations reveals new regulatory mechanisms of its tumor suppressor functions. Neoplasia (New York, N.y.). 2012;14(10):986-93. PubMed |
Streppel, M M; Lata, S; DelaBastide, M; Montgomery, E A; Wang, J S; Canto, M I; Macgregor-Das, A M; Pai, S; Morsink, F H M; Offerhaus, G J; Antoniou, E; Maitra, A; McCombie, W R. Next-generation sequencing of endoscopic biopsies identifies ARID1A as a tumor-suppressor gene in Barrett's esophagus. Oncogene. 2014;33(3):347-57. PubMed |
Mao, Tsui-Lien; Ardighieri, Laura; Ayhan, Ayse; Kuo, Kuan-Ting; Wu, Chen-Hsuan; Wang, Tian-Li; Shih, Ie-Ming. Loss of ARID1A expression correlates with stages of tumor progression in uterine endometrioid carcinoma. The American Journal Of Surgical Pathology. 2013;37(9):1342-8. PubMed |
Wu, Ren-Chin; Ayhan, Ayse; Maeda, Daichi; Kim, Kyu-Rae; Clarke, Blaise A; Shaw, Patricia; Chui, Michael Herman; Rosen, Barry; Shih, Ie-Ming; Wang, Tian-Li. Frequent somatic mutations of the telomerase reverse transcriptase promoter in ovarian clear cell carcinoma but not in other major types of gynaecological malignancy. The Journal Of Pathology. 2014;232(4):473-81. PubMed |
Wiegand, Kimberly C; Hennessy, Bryan T; Leung, Samuel; Wang, Yemin; Ju, Zhenlin; McGahren, Mollianne; Kalloger, Steve E; Finlayson, Sarah; Stemke-Hale, Katherine; Lu, Yiling; Zhang, Fan; Anglesio, Michael S; Gilks, Blake; Mills, Gordon B; Huntsman, David G; Carey, Mark S. A functional proteogenomic analysis of endometrioid and clear cell carcinomas using reverse phase protein array and mutation analysis: protein expression is histotype-specific and loss of ARID1A/BAF250a is associated with AKT phosphorylation. Bmc Cancer. 2014;14( 24559118):120. PubMed |
Howat, Will; Miller, Jodi; Gounaris, Ioannis. Application of ARID1A to murine formalin-fixed paraffin embedded tissue using immunohistochemistry. F1000research. 3( 25653835):244. PubMed |
Inada, Ryo; Sekine, Shigeki; Taniguchi, Hirokazu; Tsuda, Hitoshi; Katai, Hitoshi; Fujiwara, Toshiyoshi; Kushima, Ryoji. ARID1A expression in gastric adenocarcinoma: clinicopathological significance and correlation with DNA mismatch repair status. World Journal Of Gastroenterology. 2015;21(7):2159-68. PubMed |
He, Fei; Li, Jie; Xu, JianFeng; Zhang, Sheng; Xu, YaPing; Zhao, WenXiu; Yin, ZhenYu; Wang, XiaoMin. Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma. Journal Of Experimental & Clinical Cancer Research : Cr. 2015;34(1):47. PubMed |
Uehara, Yuriko; Oda, Katsutoshi; Ikeda, Yuji; Koso, Takahiro; Tsuji, Shingo; Yamamoto, Shogo; Asada, Kayo; Sone, Kenbun; Kurikawa, Reiko; Makii, Chinami; Hagiwara, Otoe; Tanikawa, Michihiro; Maeda, Daichi; Hasegawa, Kosei; Nakagawa, Shunsuke; Wada-Hiraike, Osamu; Kawana, Kei; Fukayama, Masashi; Fujiwara, Keiichi; Yano, Tetsu; Osuga, Yutaka; Fujii, Tomoyuki; Aburatani, Hiroyuki. Integrated copy number and expression analysis identifies profiles of whole-arm chromosomal alterations and subgroups with favorable outcome in ovarian clear cell carcinomas. Plos One. 10(6):e0128066. PubMed |
Abe, Hiroyuki; Hayashi, Akimasa; Kunita, Akiko; Sakamoto, Yoshihiro; Hasegawa, Kiyoshi; Shibahara, Junji; Kokudo, Norihiro; Fukayama, Masashi. Altered expression of AT-rich interactive domain 1A in hepatocellular carcinoma. International Journal Of Clinical And Experimental Pathology. 8(3):2763-70. PubMed |
Ibarrola-Villava, Maider; Llorca-Cardeñosa, Marta J; Tarazona, Noelia; Mongort, Cristina; Fleitas, Tania; Perez-Fidalgo, José Alejandro; Roselló, Susana; Navarro, Samuel; Ribas, Gloria; Cervantes, Andrés. Deregulation of ARID1A, CDH1, cMET and PIK3CA and target-related microRNA expression in gastric cancer. Oncotarget. 2015;6(29):26935-45. PubMed |
Jiang, Wei; Dulaimi, Essel; Devarajan, Karthik; Parsons, Theodore; Wang, Qiong; Liao, Lili; Cho, Eun-Ah; O'Neill, Raymond; Solomides, Charalambos; Peiper, Stephen C; Testa, Joseph R; Uzzo, Robert; Yang, Haifeng. Immunohistochemistry Successfully Uncovers Intratumoral Heterogeneity and Widespread Co-Losses of Chromatin Regulators in Clear Cell Renal Cell Carcinoma. Plos One. 11(10):e0164554. PubMed |
Anglesio, Michael S; Papadopoulos, Nickolas; Ayhan, Ayse; Nazeran, Tayyebeh M; Noë, Michaël; Horlings, Hugo M; Lum, Amy; Jones, Siân; Senz, Janine; Seckin, Tamer; Ho, Julie; Wu, Ren-Chin; Lac, Vivian; Ogawa, Hiroshi; Tessier-Cloutier, Basile; Alhassan, Rami; Wang, Amy; Wang, Yuxuan; Cohen, Joshua D; Wong, Fontayne; Hasanovic, Adnan; Orr, Natasha; Zhang, Ming; Popoli, Maria; McMahon, Wyatt; Wood, Laura D; Mattox, Austin; Allaire, Catherine; Segars, James; Williams, Christina; Tomasetti, Cristian; Boyd, Niki; Kinzler, Kenneth W; Gilks, C Blake; Diaz, Luis; Wang, Tian-Li; Vogelstein, Bert; Yong, Paul J; Huntsman, David G; Shih, Ie-Ming. Cancer-Associated Mutations in Endometriosis without Cancer. The New England Journal Of Medicine. 2017;376(19):1835-1848. PubMed |
Sun, Xuxu; Wang, Sam C; Wei, Yonglong; Luo, Xin; Jia, Yuemeng; Li, Lin; Gopal, Purva; Zhu, Min; Nassour, Ibrahim; Chuang, Jen-Chieh; Maples, Thomas; Celen, Cemre; Nguyen, Liem H; Wu, Linwei; Fu, Shunjun; Li, Weiping; Hui, Lijian; Tian, Feng; Ji, Yuan; Zhang, Shuyuan; Sorouri, Mahsa; Hwang, Tae Hyun; Letzig, Lynda; James, Laura; Wang, Zixi; Yopp, Adam C; Singal, Amit G; Zhu, Hao. Arid1a Has Context-Dependent Oncogenic and Tumor Suppressor Functions in Liver Cancer. Cancer Cell. 2017;32(5):574-589.e6. PubMed |
Lac, V; Verhoef, L; Aguirre-Hernandez, R; Nazeran, T M; Tessier-Cloutier, B; Praetorius, T; Orr, N L; Noga, H; Lum, A; Khattra, J; Prentice, L M; Co, D; Köbel, M; Mijatovic, V; Lee, A F; Pasternak, J; Bleeker, M C; Krämer, B; Brucker, S Y; Kommoss, F; Kommoss, S; Horlings, H M; Yong, P J; Huntsman, D G; Anglesio, M S. Iatrogenic endometriosis harbors somatic cancer-driver mutations. Human Reproduction (Oxford, England). 2019;34(1):69-78. PubMed |
Farnaby, William; Koegl, Manfred; Roy, Michael J; Whitworth, Claire; Diers, Emelyne; Trainor, Nicole; Zollman, David; Steurer, Steffen; Karolyi-Oezguer, Jale; Riedmueller, Carina; Gmaschitz, Teresa; Wachter, Johannes; Dank, Christian; Galant, Michael; Sharps, Bernadette; Rumpel, Klaus; Traxler, Elisabeth; Gerstberger, Thomas; Schnitzer, Renate; Petermann, Oliver; Greb, Peter; Weinstabl, Harald; Bader, Gerd; Zoephel, Andreas; Weiss-Puxbaum, Alexander; Ehrenhöfer-Wölfer, Katharina; Wöhrle, Simon; Boehmelt, Guido; Rinnenthal, Joerg; Arnhof, Heribert; Wiechens, Nicola; Wu, Meng-Ying; Owen-Hughes, Tom; Ettmayer, Peter; Pearson, Mark; McConnell, Darryl B; Ciulli, Alessio. BAF complex vulnerabilities in cancer demonstrated via structure-based PROTAC design. Nature Chemical Biology. 2019;15(7):672-680. PubMed |
Luo, Qingyu; Wu, Xiaowei; Chang, Wan; Zhao, Pengfei; Nan, Yabing; Zhu, Xiaolin; Katz, Jonathan P; Su, Dan; Liu, Zhihua. ARID1A prevents squamous cell carcinoma initiation and chemoresistance by antagonizing pRb/E2F1/c-Myc-mediated cancer stemness. Cell Death And Differentiation. 2020;27(6):1981-1997. PubMed |
Cao, Qifeng; Wang, Chen; Ding, Yu; Xu, Ding; Qian, Subo; Shen, Haibo; Qi, Jun. ARID1A upregulation predicts better survival in patients with urothelial bladder carcinoma. The Journal Of International Medical Research. 2020;48(4):300060519895687. PubMed |
Nagarajan, Sankari; Rao, Shalini V; Sutton, Joseph; Cheeseman, Danya; Dunn, Shanade; Papachristou, Evangelia K; Prada, Jose-Enrique Gonzalez; Couturier, Dominique-Laurent; Kumar, Sanjeev; Kishore, Kamal; Chilamakuri, Chandra Sekhar Reddy; Glont, Silvia-Elena; Archer Goode, Emily; Brodie, Cara; Guppy, Naomi; Natrajan, Rachael; Bruna, Alejandra; Caldas, Carlos; Russell, Alasdair; Siersbæk, Rasmus; Yusa, Kosuke; Chernukhin, Igor; Carroll, Jason S. ARID1A influences HDAC1/BRD4 activity, intrinsic proliferative capacity and breast cancer treatment response. Nature Genetics. 2020;52(2):187-197. PubMed |
Erfani, Mehran; Hosseini, Seyed Vahid; Mokhtari, Maral; Zamani, Mozhdeh; Tahmasebi, Kamran; Alizadeh Naini, Mahvash; Taghavi, Alireza; Carethers, John M; Koi, Minoru; Brim, Hassan; Mokarram, Pooneh; Ashktorab, Hassan. Altered ARID1A expression in colorectal cancer. Bmc Cancer. 2020;20(1):350. PubMed |
Suryo Rahmanto, Yohan; Shen, Wenjing; Shi, Xu; Chen, Xi; Yu, Yu; Yu, Zheng-Cheng; Miyamoto, Tsutomu; Lee, Meng-Horng; Singh, Vivek; Asaka, Ryoichi; Shimberg, Geoffrey; Vitolo, Michele I; Martin, Stuart S; Wirtz, Denis; Drapkin, Ronny; Xuan, Jianhua; Wang, Tian-Li; Shih, Ie-Ming. Inactivation of Arid1a in the endometrium is associated with endometrioid tumorigenesis through transcriptional reprogramming. Nature Communications. 2020;11(1):2717. PubMed |
Peng, Xue-Qi; Dai, Shang-Kun; Li, Chang-Ping; Liu, Pei-Pei; Wang, Zhi-Meng; Du, Hong-Zhen; Teng, Zhao-Qian; Yang, Shu-Guang; Liu, Chang-Mei. Loss of Arid1a Promotes Neuronal Survival Following Optic Nerve Injury. Frontiers In Cellular Neuroscience. 14( 32670021):131. PubMed |
Yachida, Nozomi; Yoshihara, Kosuke; Suda, Kazuaki; Nakaoka, Hirofumi; Ueda, Haruka; Sugino, Kentaro; Yamaguchi, Manako; Mori, Yutaro; Yamawaki, Kaoru; Tamura, Ryo; Ishiguro, Tatsuya; Isobe, Masanori; Motoyama, Teiichi; Inoue, Ituro; Enomoto, Takayuki. ARID1A protein expression is retained in ovarian endometriosis with ARID1A loss-of-function mutations: implication for the two-hit hypothesis. Scientific Reports. 2020;10(1):14260. PubMed |
Wang, Yemin; Tao, Valerie Lan; Shin, Chae Young; Salamanca, Clara; Chen, Shary Yuting; Chow, Christine; Köbel, Martin; Ben-Neriah, Susana; Farnell, David; Steidl, Christian; Mcalpine, Jessica N; Gilks, C Blake; Huntsman, David G. Establishment and characterization of VOA1066 cells: An undifferentiated endometrial carcinoma cell line. Plos One. 15(10):e0240412. PubMed |
Wang, Shuang-Yu; Yin, Lei; Wang, Chen; Ma, Ming-Ping. Atypical magnetic resonance imaging features and differential diagnosis of hepatocellular carcinoma. The Journal Of International Medical Research. 2020;48(10):300060520943415. PubMed |
Tessier-Cloutier, Basile; Coatham, Mackenzie; Carey, Mark; Nelson, Gregg S; Hamilton, Sarah; Lum, Amy; Soslow, Robert A; Stewart, Colin Jr; Postovit, Lynne M; Köbel, Martin; Lee, Cheng-Han. SWI/SNF-deficiency defines highly aggressive undifferentiated endometrial carcinoma. The Journal Of Pathology. Clinical Research. 2021;7(2):144-153. PubMed |
Zhou, Feng; Zhang, Xiaofei; Chen, Hao; Zheng, Wenxin. Dedifferentiated Endometrioid Carcinomas with Neuroendocrine Differentiation: A Clinicopathological and Immunohistochemical Study of Three Cases. Cancer Management And Research. 12( 33223851):11623-11629. PubMed |
Namjan, Achira; Techasen, Anchalee; Loilome, Watcharin; Sa-Ngaimwibool, Prakasit; Jusakul, Apinya. ARID1A alterations and their clinical significance in cholangiocarcinoma. Peerj. 8( 33344089):e10464. PubMed |
Kim, Jisup; Park, Jee-Young; Shin, Su-Jin; Lim, Beom Jin; Go, Heounjeong. Neo-Fs Index: A Novel Immunohistochemical Biomarker Panel Predicts Survival and Response to Anti-Angiogenetic Agents in Clear Cell Renal Cell Carcinoma. Cancers. 2021;13(6) PubMed |
Watkins, Jaclyn C; Downing, Michael J; Crous-Bou, Marta; Busch, Evan L; Chen, Maxine; De Vivo, Immaculata; Mutter, George L. Endometrial Tumor Classification by Histomorphology and Biomarkers in the Nurses' Health Study. Journal Of Cancer Epidemiology. 2021( 33986807):8884364. PubMed |
Clemente, Valentino; Hoshino, Asumi; Shetty, Mihir; Nelson, Andrew; Erickson, Britt K; Baker, Ruth; Rubin, Nathan; Khalifa, Mahmoud; Weroha, S John; Lou, Emil; Bazzaro, Martina. GLS1 is a protective factor in patients with ovarian clear cell carcinoma and its expression does not correlate with ARID1A-mutated tumors. Cancer Research Communications. 2022;2(8):784-794. PubMed |
Liu, Pei-Pei; Dai, Shang-Kun; Mi, Ting-Wei; Tang, Gang-Bin; Wang, Zhuo; Wang, Hui; Du, Hong-Zhen; Tang, Yi; Teng, Zhao-Qian; Liu, Chang-Mei. Acetate supplementation restores cognitive deficits caused by ARID1A haploinsufficiency in excitatory neurons. Embo Molecular Medicine. 2022;14(12):e15795. PubMed |
Li, Ni; Liu, Qiuli; Han, Ying; Pei, Siyu; Cheng, Bisheng; Xu, Junyu; Miao, Xiang; Pan, Qiang; Wang, Hanling; Guo, Jiacheng; Wang, Xuege; Zhang, Guoying; Lian, Yannan; Zhang, Wei; Zang, Yi; Tan, Minjia; Li, Qintong; Wang, Xiaoming; Xiao, Yichuan; Hu, Guohong; Jiang, Jun; Huang, Hai; Qin, Jun. ARID1A loss induces polymorphonuclear myeloid-derived suppressor cell chemotaxis and promotes prostate cancer progression. Nature Communications. 2022;13(1):7281. PubMed |
Kao, Chien-Hsiang; Liu, Chien-Ting; Lin, Hao; Huang, Yung-Cheng; Lan, Jui; Ou, Yu-Che; Fu, Hung-Chun; Wu, Chen-Hsuan. Case report: Durable response after pembrolizumab in combination with radiation - induced abscopal effect in platinum - refractory metastatic endometrial clear cell carcinoma. Frontiers In Immunology. 13( 36591227):1079253. PubMed |
Asaka, Shiho; Yen, Ting-Tai; Wang, Tian-Li; Shih, Ie-Ming; Gaillard, Stephanie. T cell-inflamed phenotype and increased Foxp3 expression in infiltrating T-cells of mismatch-repair deficient endometrial cancers. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2019;32(4):576-584. PubMed |
Kung, Ching-Yun; Fang, Wen-Liang; Hung, Yi-Ping; Huang, Kuo-Hung; Chen, Ming-Huang; Chao, Yee; Lin, Shih-Chieh; Li, Anna Fen-Yau; Lo, Su-Shun; Wu, Chew-Wun. Comparison of the mutation patterns between tumor tissue and cell-free DNA in stage IV gastric cancer. Aging. 2023;15(3):777-790. PubMed |
Dong, Xiaochuan; Song, Shumei; Li, Yuan; Fan, Yibo; Wang, Lulu; Wang, Ruiping; Huo, Longfei; Scott, Ailing; Xu, Yan; Pizzi, Melissa Pool; Ma, Lang; Wang, Ying; Jin, Jiangkang; Zhao, Wei; Yao, Xiaodan; Johnson, Randy L; Wang, Linghua; Wang, Zhenning; Peng, Guang; Ajani, Jaffer A. Loss of ARID1A activates mTOR signaling and SOX9 in gastric adenocarcinoma-rationale for targeting ARID1A deficiency. Gut. 2022;71(3):467-478. PubMed |