Anti ARHGEF9 pAb (ATL-HPA055291)

Atlas Antibodies

Catalog No.:
ATL-HPA055291-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Cdc42 guanine nucleotide exchange factor (GEF) 9
Gene Name: ARHGEF9
Alternative Gene Name: KIAA0424, PEM-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025656: 98%, ENSRNOG00000013707: 47%
Entrez Gene ID: 23229
Uniprot ID: O43307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Gene Sequence VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Gene ID - Mouse ENSMUSG00000025656
Gene ID - Rat ENSRNOG00000013707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF9 pAb (ATL-HPA055291)
Datasheet Anti ARHGEF9 pAb (ATL-HPA055291) Datasheet (External Link)
Vendor Page Anti ARHGEF9 pAb (ATL-HPA055291) at Atlas Antibodies

Documents & Links for Anti ARHGEF9 pAb (ATL-HPA055291)
Datasheet Anti ARHGEF9 pAb (ATL-HPA055291) Datasheet (External Link)
Vendor Page Anti ARHGEF9 pAb (ATL-HPA055291)