Anti ARHGEF9 pAb (ATL-HPA055291)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055291-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARHGEF9
Alternative Gene Name: KIAA0424, PEM-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025656: 98%, ENSRNOG00000013707: 47%
Entrez Gene ID: 23229
Uniprot ID: O43307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK |
| Gene Sequence | VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK |
| Gene ID - Mouse | ENSMUSG00000025656 |
| Gene ID - Rat | ENSRNOG00000013707 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGEF9 pAb (ATL-HPA055291) | |
| Datasheet | Anti ARHGEF9 pAb (ATL-HPA055291) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF9 pAb (ATL-HPA055291) at Atlas Antibodies |
| Documents & Links for Anti ARHGEF9 pAb (ATL-HPA055291) | |
| Datasheet | Anti ARHGEF9 pAb (ATL-HPA055291) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF9 pAb (ATL-HPA055291) |