Anti ARHGEF9 pAb (ATL-HPA055291)

Atlas Antibodies

SKU: ATL-HPA055291-25

• 

Protein Description: Cdc42 guanine nucleotide exchange factor (GEF) 9
Gene Name: ARHGEF9
Alternative Gene Name: KIAA0424, PEM-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025656: 98%, ENSRNOG00000013707: 47%
Entrez Gene ID: 23229
Uniprot ID: O43307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
• Gene Sequence: VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
• Gene ID - Mouse: ENSMUSG00000025656
• Gene ID - Rat: ENSRNOG00000013707
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.