Anti ARHGEF7 pAb (ATL-HPA004744 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004744-25

• 
• 

Protein Description: Rho guanine nucleotide exchange factor (GEF) 7
Gene Name: ARHGEF7
Alternative Gene Name: BETA-PIX, COOL1, DKFZp686C12170, DKFZp761K1021, KIAA0142, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031511: 94%, ENSRNOG00000012934: 95%
Entrez Gene ID: 8874
Uniprot ID: Q14155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
• Gene Sequence: RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
• Gene ID - Mouse: ENSMUSG00000031511
• Gene ID - Rat: ENSRNOG00000012934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGEF7 pAb (ATL-HPA004744 w/enhanced validation) – 1 Found

Klebanovych, Anastasiya; Sládková, Vladimíra; Sulimenko, Tetyana; Vosecká, Věra; Čapek, Martin; Dráberová, Eduarda; Dráber, Pavel; Sulimenko, Vadym. Regulation of Microtubule Nucleation in Mouse Bone Marrow-Derived Mast Cells by Protein Tyrosine Phosphatase SHP-1. Cells. 2019;8(4)