Anti ARHGEF40 pAb (ATL-HPA030746)

Atlas Antibodies

Catalog No.:
ATL-HPA030746-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 40
Gene Name: ARHGEF40
Alternative Gene Name: FLJ10357, solo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004562: 87%, ENSRNOG00000052354: 86%
Entrez Gene ID: 55701
Uniprot ID: Q8TER5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIHQLVRLSNLHVQQQEQRQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQAREALALEENATSQKVLDIFEQRLEQ
Gene Sequence AIHQLVRLSNLHVQQQEQRQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQAREALALEENATSQKVLDIFEQRLEQ
Gene ID - Mouse ENSMUSG00000004562
Gene ID - Rat ENSRNOG00000052354
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF40 pAb (ATL-HPA030746)
Datasheet Anti ARHGEF40 pAb (ATL-HPA030746) Datasheet (External Link)
Vendor Page Anti ARHGEF40 pAb (ATL-HPA030746) at Atlas Antibodies

Documents & Links for Anti ARHGEF40 pAb (ATL-HPA030746)
Datasheet Anti ARHGEF40 pAb (ATL-HPA030746) Datasheet (External Link)
Vendor Page Anti ARHGEF40 pAb (ATL-HPA030746)