Anti ARHGEF4 pAb (ATL-HPA018267)

Atlas Antibodies

SKU:
ATL-HPA018267-25
  • Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neurons.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 4
Gene Name: ARHGEF4
Alternative Gene Name: ASEF, KIAA1112, STM6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037509: 89%, ENSRNOG00000014035: 89%
Entrez Gene ID: 50649
Uniprot ID: Q9NR80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
Gene Sequence VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
Gene ID - Mouse ENSMUSG00000037509
Gene ID - Rat ENSRNOG00000014035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGEF4 pAb (ATL-HPA018267)
Datasheet Anti ARHGEF4 pAb (ATL-HPA018267) Datasheet (External Link)
Vendor Page Anti ARHGEF4 pAb (ATL-HPA018267) at Atlas Antibodies

Documents & Links for Anti ARHGEF4 pAb (ATL-HPA018267)
Datasheet Anti ARHGEF4 pAb (ATL-HPA018267) Datasheet (External Link)
Vendor Page Anti ARHGEF4 pAb (ATL-HPA018267)