Anti ARHGEF39 pAb (ATL-HPA061299)

Atlas Antibodies

Catalog No.:
ATL-HPA061299-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 39
Gene Name: ARHGEF39
Alternative Gene Name: C9orf100, FLJ14642
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051517: 88%, ENSRNOG00000021433: 90%
Entrez Gene ID: 84904
Uniprot ID: Q8N4T4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVAL
Gene Sequence ELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVAL
Gene ID - Mouse ENSMUSG00000051517
Gene ID - Rat ENSRNOG00000021433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF39 pAb (ATL-HPA061299)
Datasheet Anti ARHGEF39 pAb (ATL-HPA061299) Datasheet (External Link)
Vendor Page Anti ARHGEF39 pAb (ATL-HPA061299) at Atlas Antibodies

Documents & Links for Anti ARHGEF39 pAb (ATL-HPA061299)
Datasheet Anti ARHGEF39 pAb (ATL-HPA061299) Datasheet (External Link)
Vendor Page Anti ARHGEF39 pAb (ATL-HPA061299)
Citations for Anti ARHGEF39 pAb (ATL-HPA061299) – 1 Found
Gao, Jian; Jia, Wei-Dong. Expression of Rho Guanine Nucleotide Exchange Factor 39 (ARHGEF39) and Its Prognostic Significance in Hepatocellular Carcinoma. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2019;25( 31626606):7826-7835.  PubMed