Anti ARHGEF38 pAb (ATL-HPA036510)

Atlas Antibodies

Catalog No.:
ATL-HPA036510-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 38
Gene Name: ARHGEF38
Alternative Gene Name: FLJ20184
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040969: 87%, ENSRNOG00000036958: 86%
Entrez Gene ID: 54848
Uniprot ID: Q9NXL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEYNQKLQEKMTPQGECSVA
Gene Sequence MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEYNQKLQEKMTPQGECSVA
Gene ID - Mouse ENSMUSG00000040969
Gene ID - Rat ENSRNOG00000036958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF38 pAb (ATL-HPA036510)
Datasheet Anti ARHGEF38 pAb (ATL-HPA036510) Datasheet (External Link)
Vendor Page Anti ARHGEF38 pAb (ATL-HPA036510) at Atlas Antibodies

Documents & Links for Anti ARHGEF38 pAb (ATL-HPA036510)
Datasheet Anti ARHGEF38 pAb (ATL-HPA036510) Datasheet (External Link)
Vendor Page Anti ARHGEF38 pAb (ATL-HPA036510)