Anti ARHGEF37 pAb (ATL-HPA053487)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053487-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARHGEF37
Alternative Gene Name: FLJ41603
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045094: 78%, ENSRNOG00000025502: 76%
Entrez Gene ID: 389337
Uniprot ID: A1IGU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TYQALNSLLVAELPQFNQLVMQWLGQILCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEKVQPPP |
| Gene Sequence | TYQALNSLLVAELPQFNQLVMQWLGQILCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEKVQPPP |
| Gene ID - Mouse | ENSMUSG00000045094 |
| Gene ID - Rat | ENSRNOG00000025502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGEF37 pAb (ATL-HPA053487) | |
| Datasheet | Anti ARHGEF37 pAb (ATL-HPA053487) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF37 pAb (ATL-HPA053487) at Atlas Antibodies |
| Documents & Links for Anti ARHGEF37 pAb (ATL-HPA053487) | |
| Datasheet | Anti ARHGEF37 pAb (ATL-HPA053487) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF37 pAb (ATL-HPA053487) |
| Citations for Anti ARHGEF37 pAb (ATL-HPA053487) – 1 Found |
| Zhang, Xin; Ren, Liangliang; Wu, Junhua; Feng, Rongni; Chen, Yunyang; Li, Ronggang; Wu, Meimei; Zheng, Mingzhu; Wu, Xing Gui; Luo, Wanjun; He, Hongle; Huang, Yanming; Tang, Miaoling; Li, Jun. ARHGEF37 overexpression promotes extravasation and metastasis of hepatocellular carcinoma via directly activating Cdc42. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):230. PubMed |