Anti ARHGEF37 pAb (ATL-HPA043885)
Atlas Antibodies
- SKU:
- ATL-HPA043885-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARHGEF37
Alternative Gene Name: FLJ41603
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045094: 89%, ENSRNOG00000025502: 90%
Entrez Gene ID: 389337
Uniprot ID: A1IGU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINTHTLSKKTTRL |
| Gene Sequence | KILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINTHTLSKKTTRL |
| Gene ID - Mouse | ENSMUSG00000045094 |
| Gene ID - Rat | ENSRNOG00000025502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGEF37 pAb (ATL-HPA043885) | |
| Datasheet | Anti ARHGEF37 pAb (ATL-HPA043885) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF37 pAb (ATL-HPA043885) at Atlas Antibodies |
| Documents & Links for Anti ARHGEF37 pAb (ATL-HPA043885) | |
| Datasheet | Anti ARHGEF37 pAb (ATL-HPA043885) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF37 pAb (ATL-HPA043885) |
| Citations for Anti ARHGEF37 pAb (ATL-HPA043885) – 1 Found |
| Viplav, Abhiyan; Saha, Tanumoy; Huertas, Jan; Selenschik, Philipp; Ebrahimkutty, Mirsana P; Grill, David; Lehrich, Julia; Hentschel, Andreas; Biasizzo, Monika; Mengoni, Simone; Ahrends, Robert; Gerke, Volker; Cojocaru, Vlad; Klingauf, Jürgen; Galic, Milos. ArhGEF37 assists dynamin 2 during clathrin-mediated endocytosis. Journal Of Cell Science. 2019;132(9) PubMed |