Anti ARHGEF33 pAb (ATL-HPA041051)

Atlas Antibodies

Catalog No.:
ATL-HPA041051-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 33
Gene Name: ARHGEF33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054901: 88%, ENSRNOG00000007061: 88%
Entrez Gene ID: 100271715
Uniprot ID: A8MVX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK
Gene Sequence GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK
Gene ID - Mouse ENSMUSG00000054901
Gene ID - Rat ENSRNOG00000007061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF33 pAb (ATL-HPA041051)
Datasheet Anti ARHGEF33 pAb (ATL-HPA041051) Datasheet (External Link)
Vendor Page Anti ARHGEF33 pAb (ATL-HPA041051) at Atlas Antibodies

Documents & Links for Anti ARHGEF33 pAb (ATL-HPA041051)
Datasheet Anti ARHGEF33 pAb (ATL-HPA041051) Datasheet (External Link)
Vendor Page Anti ARHGEF33 pAb (ATL-HPA041051)