Anti ARHGEF33 pAb (ATL-HPA041051)
Atlas Antibodies
- SKU:
- ATL-HPA041051-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARHGEF33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054901: 88%, ENSRNOG00000007061: 88%
Entrez Gene ID: 100271715
Uniprot ID: A8MVX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK |
Gene Sequence | GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK |
Gene ID - Mouse | ENSMUSG00000054901 |
Gene ID - Rat | ENSRNOG00000007061 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARHGEF33 pAb (ATL-HPA041051) | |
Datasheet | Anti ARHGEF33 pAb (ATL-HPA041051) Datasheet (External Link) |
Vendor Page | Anti ARHGEF33 pAb (ATL-HPA041051) at Atlas Antibodies |
Documents & Links for Anti ARHGEF33 pAb (ATL-HPA041051) | |
Datasheet | Anti ARHGEF33 pAb (ATL-HPA041051) Datasheet (External Link) |
Vendor Page | Anti ARHGEF33 pAb (ATL-HPA041051) |