Anti ARHGEF33 pAb (ATL-HPA041051)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041051-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARHGEF33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054901: 88%, ENSRNOG00000007061: 88%
Entrez Gene ID: 100271715
Uniprot ID: A8MVX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK |
| Gene Sequence | GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK |
| Gene ID - Mouse | ENSMUSG00000054901 |
| Gene ID - Rat | ENSRNOG00000007061 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGEF33 pAb (ATL-HPA041051) | |
| Datasheet | Anti ARHGEF33 pAb (ATL-HPA041051) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF33 pAb (ATL-HPA041051) at Atlas Antibodies |
| Documents & Links for Anti ARHGEF33 pAb (ATL-HPA041051) | |
| Datasheet | Anti ARHGEF33 pAb (ATL-HPA041051) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF33 pAb (ATL-HPA041051) |