Anti ARHGEF3 pAb (ATL-HPA034715)

Atlas Antibodies

SKU: ATL-HPA034715-25

• 
• 

Protein Description: Rho guanine nucleotide exchange factor (GEF) 3
Gene Name: ARHGEF3
Alternative Gene Name: DKFZP434F2429, GEF3, STA3, XPLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021895: 86%, ENSRNOG00000014363: 85%
Entrez Gene ID: 50650
Uniprot ID: Q9NR81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSDSESDCSM
• Gene Sequence: HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSDSESDCSM
• Gene ID - Mouse: ENSMUSG00000021895
• Gene ID - Rat: ENSRNOG00000014363
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGEF3 pAb (ATL-HPA034715) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.