Anti ARHGEF28 pAb (ATL-HPA037602 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA037602-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-ARHGEF28 antibody. Corresponding ARHGEF28 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 28
Gene Name: ARHGEF28
Alternative Gene Name: p190RhoGEF, RGNEF, RIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021662: 80%, ENSRNOG00000016544: 74%
Entrez Gene ID: 64283
Uniprot ID: Q8N1W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI
Gene Sequence GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI
Gene ID - Mouse ENSMUSG00000021662
Gene ID - Rat ENSRNOG00000016544
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ARHGEF28 pAb (ATL-HPA037602 w/enhanced validation)
Datasheet Anti ARHGEF28 pAb (ATL-HPA037602 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGEF28 pAb (ATL-HPA037602 w/enhanced validation)



Citations for Anti ARHGEF28 pAb (ATL-HPA037602 w/enhanced validation) – 1 Found
Wells, Helena R R; Freidin, Maxim B; Zainul Abidin, Fatin N; Payton, Antony; Dawes, Piers; Munro, Kevin J; Morton, Cynthia C; Moore, David R; Dawson, Sally J; Williams, Frances M K. GWAS Identifies 44 Independent Associated Genomic Loci for Self-Reported Adult Hearing Difficulty in UK Biobank. American Journal Of Human Genetics. 2019;105(4):788-802.  PubMed