Anti ARHGEF26 pAb (ATL-HPA017722)

Atlas Antibodies

SKU:
ATL-HPA017722-25
  • Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells as well as in the muscular layers.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 26
Gene Name: ARHGEF26
Alternative Gene Name: DKFZP434D146, SGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036885: 70%, ENSRNOG00000014549: 71%
Entrez Gene ID: 26084
Uniprot ID: Q96DR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNV
Gene Sequence PEEDLTGLTASPVPSPTANGLAANNDSPGSGSQSGRKAKDPERGLFPGPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSPAALKVGKQQIIPKSLASEIKISKSNNQNV
Gene ID - Mouse ENSMUSG00000036885
Gene ID - Rat ENSRNOG00000014549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGEF26 pAb (ATL-HPA017722)
Datasheet Anti ARHGEF26 pAb (ATL-HPA017722) Datasheet (External Link)
Vendor Page Anti ARHGEF26 pAb (ATL-HPA017722) at Atlas Antibodies

Documents & Links for Anti ARHGEF26 pAb (ATL-HPA017722)
Datasheet Anti ARHGEF26 pAb (ATL-HPA017722) Datasheet (External Link)
Vendor Page Anti ARHGEF26 pAb (ATL-HPA017722)