Anti ARHGEF18 pAb (ATL-HPA042689)

Atlas Antibodies

SKU: ATL-HPA042689-25

• 
• 

Protein Description: Rho/Rac guanine nucleotide exchange factor (GEF) 18
Gene Name: ARHGEF18
Alternative Gene Name: KIAA0521, MGC15913, P114-RhoGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004568: 46%, ENSRNOG00000028090: 68%
Entrez Gene ID: 23370
Uniprot ID: Q6ZSZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI
• Gene Sequence: RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI
• Gene ID - Mouse: ENSMUSG00000004568
• Gene ID - Rat: ENSRNOG00000028090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGEF18 pAb (ATL-HPA042689) – 2 Found

Artym, Vira V; Swatkoski, Stephen; Matsumoto, Kazue; Campbell, Catherine B; Petrie, Ryan J; Dimitriadis, Emilios K; Li, Xin; Mueller, Susette C; Bugge, Thomas H; Gucek, Marjan; Yamada, Kenneth M. Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network. The Journal Of Cell Biology. 2015;208(3):331-50. 

Frauenstein, Annika; Ebner, Stefan; Hansen, Fynn M; Sinha, Ankit; Phulphagar, Kshiti; Swatek, Kirby; Hornburg, Daniel; Mann, Matthias; Meissner, Felix. Identification of covalent modifications regulating immune signaling complex composition and phenotype. Molecular Systems Biology. 2021;17(7):e10125.