Anti ARHGEF18 pAb (ATL-HPA042689)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042689-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARHGEF18
Alternative Gene Name: KIAA0521, MGC15913, P114-RhoGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004568: 46%, ENSRNOG00000028090: 68%
Entrez Gene ID: 23370
Uniprot ID: Q6ZSZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI |
| Gene Sequence | RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI |
| Gene ID - Mouse | ENSMUSG00000004568 |
| Gene ID - Rat | ENSRNOG00000028090 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGEF18 pAb (ATL-HPA042689) | |
| Datasheet | Anti ARHGEF18 pAb (ATL-HPA042689) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF18 pAb (ATL-HPA042689) at Atlas Antibodies |
| Documents & Links for Anti ARHGEF18 pAb (ATL-HPA042689) | |
| Datasheet | Anti ARHGEF18 pAb (ATL-HPA042689) Datasheet (External Link) |
| Vendor Page | Anti ARHGEF18 pAb (ATL-HPA042689) |
| Citations for Anti ARHGEF18 pAb (ATL-HPA042689) – 2 Found |
| Artym, Vira V; Swatkoski, Stephen; Matsumoto, Kazue; Campbell, Catherine B; Petrie, Ryan J; Dimitriadis, Emilios K; Li, Xin; Mueller, Susette C; Bugge, Thomas H; Gucek, Marjan; Yamada, Kenneth M. Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network. The Journal Of Cell Biology. 2015;208(3):331-50. PubMed |
| Frauenstein, Annika; Ebner, Stefan; Hansen, Fynn M; Sinha, Ankit; Phulphagar, Kshiti; Swatek, Kirby; Hornburg, Daniel; Mann, Matthias; Meissner, Felix. Identification of covalent modifications regulating immune signaling complex composition and phenotype. Molecular Systems Biology. 2021;17(7):e10125. PubMed |