Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA011026-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 11
Gene Name: ARHGEF11
Alternative Gene Name: GTRAP48, KIAA0380, PDZ-RHOGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041977: 90%, ENSRNOG00000015026: 88%
Entrez Gene ID: 9826
Uniprot ID: O15085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA
Gene Sequence LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA
Gene ID - Mouse ENSMUSG00000041977
Gene ID - Rat ENSRNOG00000015026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation)
Datasheet Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation)
Datasheet Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation)
Citations for Anti ARHGEF11 pAb (ATL-HPA011026 w/enhanced validation) – 3 Found
Rozbicki, Emil; Chuai, Manli; Karjalainen, Antti I; Song, Feifei; Sang, Helen M; Martin, René; Knölker, Hans-Joachim; MacDonald, Michael P; Weijer, Cornelis J. Myosin-II-mediated cell shape changes and cell intercalation contribute to primitive streak formation. Nature Cell Biology. 2015;17(4):397-408.  PubMed
Cervantes-Villagrana, Rodolfo Daniel; Color-Aparicio, Víctor Manuel; Reyes-Cruz, Guadalupe; Vázquez-Prado, José. Protumoral bone marrow-derived cells migrate via Gβγ-dependent signaling pathways and exhibit a complex repertoire of RhoGEFs. Journal Of Cell Communication And Signaling. 2019;13(2):179-191.  PubMed
Härmä, V; Knuuttila, M; Virtanen, J; Mirtti, T; Kohonen, P; Kovanen, P; Happonen, A; Kaewphan, S; Ahonen, I; Kallioniemi, O; Grafström, R; Lötjönen, J; Nees, M. Lysophosphatidic acid and sphingosine-1-phosphate promote morphogenesis and block invasion of prostate cancer cells in three-dimensional organotypic models. Oncogene. 2012;31(16):2075-89.  PubMed