Anti ARHGEF10L pAb (ATL-HPA028115)

Atlas Antibodies

Catalog No.:
ATL-HPA028115-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 10-like
Gene Name: ARHGEF10L
Alternative Gene Name: FLJ10521, KIAA1626
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040964: 95%, ENSRNOG00000050636: 95%
Entrez Gene ID: 55160
Uniprot ID: Q9HCE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
Gene Sequence LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
Gene ID - Mouse ENSMUSG00000040964
Gene ID - Rat ENSRNOG00000050636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF10L pAb (ATL-HPA028115)
Datasheet Anti ARHGEF10L pAb (ATL-HPA028115) Datasheet (External Link)
Vendor Page Anti ARHGEF10L pAb (ATL-HPA028115) at Atlas Antibodies

Documents & Links for Anti ARHGEF10L pAb (ATL-HPA028115)
Datasheet Anti ARHGEF10L pAb (ATL-HPA028115) Datasheet (External Link)
Vendor Page Anti ARHGEF10L pAb (ATL-HPA028115)