Anti ARHGEF10L pAb (ATL-HPA028115)

Atlas Antibodies

Catalog No.: ATL-HPA028115-25

Protein Description: Rho guanine nucleotide exchange factor (GEF) 10-like
Gene Name: ARHGEF10L
Alternative Gene Name: FLJ10521, KIAA1626
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040964: 95%, ENSRNOG00000050636: 95%
Entrez Gene ID: 55160
Uniprot ID: Q9HCE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
• Gene Sequence: LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYL
• Gene ID - Mouse: ENSMUSG00000040964
• Gene ID - Rat: ENSRNOG00000050636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.