Anti ARHGDIA pAb (ATL-HPA021407)

Atlas Antibodies

SKU:
ATL-HPA021407-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules.
  • Western blot analysis in human cell line SH-SY5Y.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Rho GDP dissociation inhibitor (GDI) alpha
Gene Name: ARHGDIA
Alternative Gene Name: GDIA1, RHOGDI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025132: 100%, ENSRNOG00000036688: 100%
Entrez Gene ID: 396
Uniprot ID: P52565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD
Gene Sequence MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD
Gene ID - Mouse ENSMUSG00000025132
Gene ID - Rat ENSRNOG00000036688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407)
Datasheet Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link)
Vendor Page Anti ARHGDIA pAb (ATL-HPA021407) at Atlas Antibodies

Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407)
Datasheet Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link)
Vendor Page Anti ARHGDIA pAb (ATL-HPA021407)



Citations for Anti ARHGDIA pAb (ATL-HPA021407) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed