Anti ARHGDIA pAb (ATL-HPA021407)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021407-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ARHGDIA
Alternative Gene Name: GDIA1, RHOGDI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025132: 100%, ENSRNOG00000036688: 100%
Entrez Gene ID: 396
Uniprot ID: P52565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD |
Gene Sequence | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD |
Gene ID - Mouse | ENSMUSG00000025132 |
Gene ID - Rat | ENSRNOG00000036688 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407) | |
Datasheet | Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link) |
Vendor Page | Anti ARHGDIA pAb (ATL-HPA021407) at Atlas Antibodies |
Documents & Links for Anti ARHGDIA pAb (ATL-HPA021407) | |
Datasheet | Anti ARHGDIA pAb (ATL-HPA021407) Datasheet (External Link) |
Vendor Page | Anti ARHGDIA pAb (ATL-HPA021407) |
Citations for Anti ARHGDIA pAb (ATL-HPA021407) – 1 Found |
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |