Anti ARHGAP44 pAb (ATL-HPA038814)

Atlas Antibodies

SKU: ATL-HPA038814-25

• 
• 

Protein Description: Rho GTPase activating protein 44
Gene Name: ARHGAP44
Alternative Gene Name: KIAA0672, RICH-2, RICH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033389: 92%, ENSRNOG00000003603: 93%
Entrez Gene ID: 9912
Uniprot ID: Q17R89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE
• Gene Sequence: STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE
• Gene ID - Mouse: ENSMUSG00000033389
• Gene ID - Rat: ENSRNOG00000003603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGAP44 pAb (ATL-HPA038814) – 1 Found

Galic, Milos; Tsai, Feng-Chiao; Collins, Sean R; Matis, Maja; Bandara, Samuel; Meyer, Tobias. Dynamic recruitment of the curvature-sensitive protein ArhGAP44 to nanoscale membrane deformations limits exploratory filopodia initiation in neurons. Elife. 2014;3( 25498153):e03116.