Anti ARHGAP44 pAb (ATL-HPA038814)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038814-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARHGAP44
Alternative Gene Name: KIAA0672, RICH-2, RICH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033389: 92%, ENSRNOG00000003603: 93%
Entrez Gene ID: 9912
Uniprot ID: Q17R89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE |
| Gene Sequence | STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE |
| Gene ID - Mouse | ENSMUSG00000033389 |
| Gene ID - Rat | ENSRNOG00000003603 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGAP44 pAb (ATL-HPA038814) | |
| Datasheet | Anti ARHGAP44 pAb (ATL-HPA038814) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP44 pAb (ATL-HPA038814) at Atlas Antibodies |
| Documents & Links for Anti ARHGAP44 pAb (ATL-HPA038814) | |
| Datasheet | Anti ARHGAP44 pAb (ATL-HPA038814) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP44 pAb (ATL-HPA038814) |
| Citations for Anti ARHGAP44 pAb (ATL-HPA038814) – 1 Found |
| Galic, Milos; Tsai, Feng-Chiao; Collins, Sean R; Matis, Maja; Bandara, Samuel; Meyer, Tobias. Dynamic recruitment of the curvature-sensitive protein ArhGAP44 to nanoscale membrane deformations limits exploratory filopodia initiation in neurons. Elife. 2014;3( 25498153):e03116. PubMed |