Anti ARHGAP40 pAb (ATL-HPA042840)

Atlas Antibodies

SKU:
ATL-HPA042840-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 40
Gene Name: ARHGAP40
Alternative Gene Name: C20orf95, dJ1100H13.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074625: 85%, ENSRNOG00000015359: 85%
Entrez Gene ID: 343578
Uniprot ID: Q5TG30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGKWKAAETRLFGVPLDSLLEADHKVLPSTQVPLVLQALLSCLEKRGLDMEGILRVPGSQARVKGLEQKLERDFYAGLFSWDEVHHNDASDLLKRFIR
Gene Sequence AGKWKAAETRLFGVPLDSLLEADHKVLPSTQVPLVLQALLSCLEKRGLDMEGILRVPGSQARVKGLEQKLERDFYAGLFSWDEVHHNDASDLLKRFIR
Gene ID - Mouse ENSMUSG00000074625
Gene ID - Rat ENSRNOG00000015359
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP40 pAb (ATL-HPA042840)
Datasheet Anti ARHGAP40 pAb (ATL-HPA042840) Datasheet (External Link)
Vendor Page Anti ARHGAP40 pAb (ATL-HPA042840) at Atlas Antibodies

Documents & Links for Anti ARHGAP40 pAb (ATL-HPA042840)
Datasheet Anti ARHGAP40 pAb (ATL-HPA042840) Datasheet (External Link)
Vendor Page Anti ARHGAP40 pAb (ATL-HPA042840)