Anti ARHGAP4 pAb (ATL-HPA001083 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001083-25

• 
• 

Protein Description: Rho GTPase activating protein 4
Gene Name: ARHGAP4
Alternative Gene Name: C1, KIAA0131, p115, RhoGAP4, SrGAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031389: 83%, ENSRNOG00000058545: 88%
Entrez Gene ID: 393
Uniprot ID: P98171
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYT
• Gene Sequence: DRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYT
• Gene ID - Mouse: ENSMUSG00000031389
• Gene ID - Rat: ENSRNOG00000058545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGAP4 pAb (ATL-HPA001083 w/enhanced validation) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.