Anti ARHGAP36 pAb (ATL-HPA076209)

Atlas Antibodies

SKU:
ATL-HPA076209-25
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in medulla.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 36
Gene Name: ARHGAP36
Alternative Gene Name: FLJ30058
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036198: 79%, ENSRNOG00000007552: 75%
Entrez Gene ID: 158763
Uniprot ID: Q6ZRI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TAYHELVARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRR
Gene Sequence TAYHELVARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRR
Gene ID - Mouse ENSMUSG00000036198
Gene ID - Rat ENSRNOG00000007552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP36 pAb (ATL-HPA076209)
Datasheet Anti ARHGAP36 pAb (ATL-HPA076209) Datasheet (External Link)
Vendor Page Anti ARHGAP36 pAb (ATL-HPA076209) at Atlas Antibodies

Documents & Links for Anti ARHGAP36 pAb (ATL-HPA076209)
Datasheet Anti ARHGAP36 pAb (ATL-HPA076209) Datasheet (External Link)
Vendor Page Anti ARHGAP36 pAb (ATL-HPA076209)