Anti ARHGAP36 pAb (ATL-HPA002064 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA002064-25

• 
• 
• 

Protein Description: Rho GTPase activating protein 36
Gene Name: ARHGAP36
Alternative Gene Name: FLJ30058
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036198: 81%, ENSRNOG00000007552: 55%
Entrez Gene ID: 158763
Uniprot ID: Q6ZRI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NWDVLFQVPPHIQRQVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQD
• Gene Sequence: NWDVLFQVPPHIQRQVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQD
• Gene ID - Mouse: ENSMUSG00000036198
• Gene ID - Rat: ENSRNOG00000007552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGAP36 pAb (ATL-HPA002064 w/enhanced validation) – 2 Found

Eccles, Rebecca L; Czajkowski, Maciej T; Barth, Carolin; Müller, Paul Markus; McShane, Erik; Grunwald, Stephan; Beaudette, Patrick; Mecklenburg, Nora; Volkmer, Rudolf; Zühlke, Kerstin; Dittmar, Gunnar; Selbach, Matthias; Hammes, Annette; Daumke, Oliver; Klussmann, Enno; Urbé, Sylvie; Rocks, Oliver. Bimodal antagonism of PKA signalling by ARHGAP36. Nature Communications. 2016;7( 27713425):12963. 

Nam, Heejin; Jeon, Shin; An, Hyejin; Yoo, Jaeyoung; Lee, Hyo-Jong; Lee, Soo-Kyung; Lee, Seunghee. Critical roles of ARHGAP36 as a signal transduction mediator of Shh pathway in lateral motor columnar specification. Elife. 2019;8( 31305241)