Anti ARHGAP35 pAb (ATL-HPA056470)

Atlas Antibodies

Catalog No.:
ATL-HPA056470-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 35
Gene Name: ARHGAP35
Alternative Gene Name: GRF-1, GRLF1, KIAA1722, P190A, p190ARhoGAP, p190RhoGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058230: 99%, ENSRNOG00000015852: 99%
Entrez Gene ID: 2909
Uniprot ID: Q9NRY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLF
Gene Sequence VNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLF
Gene ID - Mouse ENSMUSG00000058230
Gene ID - Rat ENSRNOG00000015852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP35 pAb (ATL-HPA056470)
Datasheet Anti ARHGAP35 pAb (ATL-HPA056470) Datasheet (External Link)
Vendor Page Anti ARHGAP35 pAb (ATL-HPA056470) at Atlas Antibodies

Documents & Links for Anti ARHGAP35 pAb (ATL-HPA056470)
Datasheet Anti ARHGAP35 pAb (ATL-HPA056470) Datasheet (External Link)
Vendor Page Anti ARHGAP35 pAb (ATL-HPA056470)
Citations for Anti ARHGAP35 pAb (ATL-HPA056470) – 1 Found
Jozic, Ivan; Abujamra, Beatriz Abdo; Elliott, Michael H; Wikramanayake, Tongyu C; Marjanovic, Jelena; Stone, Rivka C; Head, Cheyanne R; Pastar, Irena; Kirsner, Robert S; Andreopoulos, Fotios M; Musi, Juan P; Tomic-Canic, Marjana. Glucocorticoid-mediated induction of caveolin-1 disrupts cytoskeletal organization, inhibits cell migration and re-epithelialization of non-healing wounds. Communications Biology. 2021;4(1):757.  PubMed