Anti ARHGAP33 pAb (ATL-HPA030118)

Atlas Antibodies

SKU:
ATL-HPA030118-25
  • Immunohistochemical staining of human adrenal gland shows cytoplasmic positivity in cortical cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 33
Gene Name: ARHGAP33
Alternative Gene Name: FLJ39019, SNX26, TCGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036882: 97%, ENSRNOG00000024677: 97%
Entrez Gene ID: 115703
Uniprot ID: O14559
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGIL
Gene Sequence PSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGIL
Gene ID - Mouse ENSMUSG00000036882
Gene ID - Rat ENSRNOG00000024677
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP33 pAb (ATL-HPA030118)
Datasheet Anti ARHGAP33 pAb (ATL-HPA030118) Datasheet (External Link)
Vendor Page Anti ARHGAP33 pAb (ATL-HPA030118) at Atlas Antibodies

Documents & Links for Anti ARHGAP33 pAb (ATL-HPA030118)
Datasheet Anti ARHGAP33 pAb (ATL-HPA030118) Datasheet (External Link)
Vendor Page Anti ARHGAP33 pAb (ATL-HPA030118)



Citations for Anti ARHGAP33 pAb (ATL-HPA030118) – 1 Found
Nakazawa, Takanobu; Hashimoto, Ryota; Sakoori, Kazuto; Sugaya, Yuki; Tanimura, Asami; Hashimotodani, Yuki; Ohi, Kazutaka; Yamamori, Hidenaga; Yasuda, Yuka; Umeda-Yano, Satomi; Kiyama, Yuji; Konno, Kohtarou; Inoue, Takeshi; Yokoyama, Kazumasa; Inoue, Takafumi; Numata, Shusuke; Ohnuma, Tohru; Iwata, Nakao; Ozaki, Norio; Hashimoto, Hitoshi; Watanabe, Masahiko; Manabe, Toshiya; Yamamoto, Tadashi; Takeda, Masatoshi; Kano, Masanobu. Emerging roles of ARHGAP33 in intracellular trafficking of TrkB and pathophysiology of neuropsychiatric disorders. Nature Communications. 2016;7( 26839058):10594.  PubMed