Anti ARHGAP33 pAb (ATL-HPA030117)

Atlas Antibodies

Catalog No.: ATL-HPA030117-25

Protein Description: Rho GTPase activating protein 33
Gene Name: ARHGAP33
Alternative Gene Name: FLJ39019, SNX26, TCGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036882: 80%, ENSRNOG00000024677: 75%
Entrez Gene ID: 115703
Uniprot ID: O14559
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKP
• Gene Sequence: PPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKP
• Gene ID - Mouse: ENSMUSG00000036882
• Gene ID - Rat: ENSRNOG00000024677
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGAP33 pAb (ATL-HPA030117) – 1 Found

Klee, Katharina M C; Hess, Michael W; Lohmüller, Michael; Herzog, Sebastian; Pfaller, Kristian; Müller, Thomas; Vogel, Georg F; Huber, Lukas A. A CRISPR screen in intestinal epithelial cells identifies novel factors for polarity and apical transport. Elife. 2023;12( 36661306)