Anti ARHGAP28 pAb (ATL-HPA030415)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030415-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARHGAP28
Alternative Gene Name: FLJ10312, KIAA1314
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024043: 76%, ENSRNOG00000017065: 76%
Entrez Gene ID: 79822
Uniprot ID: Q9P2N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSIPRCRRINRMLSNESLHPPAFSRSNSEASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVD |
Gene Sequence | KSIPRCRRINRMLSNESLHPPAFSRSNSEASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVD |
Gene ID - Mouse | ENSMUSG00000024043 |
Gene ID - Rat | ENSRNOG00000017065 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARHGAP28 pAb (ATL-HPA030415) | |
Datasheet | Anti ARHGAP28 pAb (ATL-HPA030415) Datasheet (External Link) |
Vendor Page | Anti ARHGAP28 pAb (ATL-HPA030415) at Atlas Antibodies |
Documents & Links for Anti ARHGAP28 pAb (ATL-HPA030415) | |
Datasheet | Anti ARHGAP28 pAb (ATL-HPA030415) Datasheet (External Link) |
Vendor Page | Anti ARHGAP28 pAb (ATL-HPA030415) |