Anti ARHGAP28 pAb (ATL-HPA030415)

Atlas Antibodies

Catalog No.:
ATL-HPA030415-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 28
Gene Name: ARHGAP28
Alternative Gene Name: FLJ10312, KIAA1314
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024043: 76%, ENSRNOG00000017065: 76%
Entrez Gene ID: 79822
Uniprot ID: Q9P2N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSIPRCRRINRMLSNESLHPPAFSRSNSEASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVD
Gene Sequence KSIPRCRRINRMLSNESLHPPAFSRSNSEASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVD
Gene ID - Mouse ENSMUSG00000024043
Gene ID - Rat ENSRNOG00000017065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP28 pAb (ATL-HPA030415)
Datasheet Anti ARHGAP28 pAb (ATL-HPA030415) Datasheet (External Link)
Vendor Page Anti ARHGAP28 pAb (ATL-HPA030415) at Atlas Antibodies

Documents & Links for Anti ARHGAP28 pAb (ATL-HPA030415)
Datasheet Anti ARHGAP28 pAb (ATL-HPA030415) Datasheet (External Link)
Vendor Page Anti ARHGAP28 pAb (ATL-HPA030415)