Anti ARHGAP28 pAb (ATL-HPA030414)

Atlas Antibodies

SKU: ATL-HPA030414-25

• 
• 
• 

Protein Description: Rho GTPase activating protein 28
Gene Name: ARHGAP28
Alternative Gene Name: FLJ10312, KIAA1314
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024043: 67%, ENSRNOG00000017065: 67%
Entrez Gene ID: 79822
Uniprot ID: Q9P2N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQSIRDVRDIFGVSESPPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIP
• Gene Sequence: KQSIRDVRDIFGVSESPPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIP
• Gene ID - Mouse: ENSMUSG00000024043
• Gene ID - Rat: ENSRNOG00000017065
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.