Anti ARHGAP27 pAb (ATL-HPA023919)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023919-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARHGAP27
Alternative Gene Name: CAMGAP1, FLJ43547, SH3D20, SH3P20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034255: 93%, ENSRNOG00000028569: 93%
Entrez Gene ID: 201176
Uniprot ID: Q6ZUM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE |
| Gene Sequence | WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE |
| Gene ID - Mouse | ENSMUSG00000034255 |
| Gene ID - Rat | ENSRNOG00000028569 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGAP27 pAb (ATL-HPA023919) | |
| Datasheet | Anti ARHGAP27 pAb (ATL-HPA023919) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP27 pAb (ATL-HPA023919) at Atlas Antibodies |
| Documents & Links for Anti ARHGAP27 pAb (ATL-HPA023919) | |
| Datasheet | Anti ARHGAP27 pAb (ATL-HPA023919) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP27 pAb (ATL-HPA023919) |