Anti ARHGAP27 pAb (ATL-HPA023919)

Atlas Antibodies

Catalog No.:
ATL-HPA023919-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 27
Gene Name: ARHGAP27
Alternative Gene Name: CAMGAP1, FLJ43547, SH3D20, SH3P20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034255: 93%, ENSRNOG00000028569: 93%
Entrez Gene ID: 201176
Uniprot ID: Q6ZUM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE
Gene Sequence WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE
Gene ID - Mouse ENSMUSG00000034255
Gene ID - Rat ENSRNOG00000028569
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP27 pAb (ATL-HPA023919)
Datasheet Anti ARHGAP27 pAb (ATL-HPA023919) Datasheet (External Link)
Vendor Page Anti ARHGAP27 pAb (ATL-HPA023919) at Atlas Antibodies

Documents & Links for Anti ARHGAP27 pAb (ATL-HPA023919)
Datasheet Anti ARHGAP27 pAb (ATL-HPA023919) Datasheet (External Link)
Vendor Page Anti ARHGAP27 pAb (ATL-HPA023919)