Anti ARHGAP27 pAb (ATL-HPA023919)

Atlas Antibodies

Catalog No.: ATL-HPA023919-25

Protein Description: Rho GTPase activating protein 27
Gene Name: ARHGAP27
Alternative Gene Name: CAMGAP1, FLJ43547, SH3D20, SH3P20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034255: 93%, ENSRNOG00000028569: 93%
Entrez Gene ID: 201176
Uniprot ID: Q6ZUM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE
• Gene Sequence: WTVLEGGVLTFFKDSKTSAAGGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQE
• Gene ID - Mouse: ENSMUSG00000034255
• Gene ID - Rat: ENSRNOG00000028569
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.