Anti ARHGAP26 pAb (ATL-HPA035107 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035107-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 26
Gene Name: ARHGAP26
Alternative Gene Name: GRAF, KIAA0621, OPHN1L, OPHN1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036452: 88%, ENSRNOG00000013920: 92%
Entrez Gene ID: 23092
Uniprot ID: Q9UNA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS
Gene Sequence HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS
Gene ID - Mouse ENSMUSG00000036452
Gene ID - Rat ENSRNOG00000013920
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ARHGAP26 pAb (ATL-HPA035107 w/enhanced validation)
Datasheet Anti ARHGAP26 pAb (ATL-HPA035107 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGAP26 pAb (ATL-HPA035107 w/enhanced validation)



Citations for Anti ARHGAP26 pAb (ATL-HPA035107 w/enhanced validation) – 2 Found
Tanaka, Atsushi; Ishikawa, Shumpei; Ushiku, Tetsuo; Yamazawa, Sho; Katoh, Hiroto; Hayashi, Akimasa; Kunita, Akiko; Fukayama, Masashi. Frequent CLDN18-ARHGAP fusion in highly metastatic diffuse-type gastric cancer with relatively early onset. Oncotarget. 2018;9(50):29336-29350.  PubMed
Bozóky, Benedek; Savchenko, Andrii; Csermely, Péter; Korcsmáros, Tamás; Dúl, Zoltán; Pontén, Fredrik; Székely, László; Klein, George. Novel signatures of cancer-associated fibroblasts. International Journal Of Cancer. 2013;133(2):286-93.  PubMed