Anti ARHGAP26 pAb (ATL-HPA035106)

Atlas Antibodies

SKU: ATL-HPA035106-25

• 
• 
• 

Protein Description: Rho GTPase activating protein 26
Gene Name: ARHGAP26
Alternative Gene Name: GRAF, KIAA0621, OPHN1L, OPHN1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036452: 96%, ENSRNOG00000013920: 56%
Entrez Gene ID: 23092
Uniprot ID: Q9UNA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
• Gene Sequence: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
• Gene ID - Mouse: ENSMUSG00000036452
• Gene ID - Rat: ENSRNOG00000013920
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.