Anti ARHGAP23 pAb (ATL-HPA019818)

Atlas Antibodies

Catalog No.: ATL-HPA019818-25

Protein Description: Rho GTPase activating protein 23
Gene Name: ARHGAP23
Alternative Gene Name: KIAA1501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049807: 97%, ENSRNOG00000022771: 94%
Entrez Gene ID: 57636
Uniprot ID: Q9P227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS
• Gene Sequence: MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS
• Gene ID - Mouse: ENSMUSG00000049807
• Gene ID - Rat: ENSRNOG00000022771
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGAP23 pAb (ATL-HPA019818) – 1 Found

Zhang, Liang; Luga, Valbona; Armitage, Sarah K; Musiol, Martin; Won, Amy; Yip, Christopher M; Plotnikov, Sergey V; Wrana, Jeffrey L. A lateral signalling pathway coordinates shape volatility during cell migration. Nature Communications. 2016;7( 27226243):11714.