Anti ARHGAP23 pAb (ATL-HPA019818)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019818-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARHGAP23
Alternative Gene Name: KIAA1501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049807: 97%, ENSRNOG00000022771: 94%
Entrez Gene ID: 57636
Uniprot ID: Q9P227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS |
| Gene Sequence | MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS |
| Gene ID - Mouse | ENSMUSG00000049807 |
| Gene ID - Rat | ENSRNOG00000022771 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGAP23 pAb (ATL-HPA019818) | |
| Datasheet | Anti ARHGAP23 pAb (ATL-HPA019818) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP23 pAb (ATL-HPA019818) at Atlas Antibodies |
| Documents & Links for Anti ARHGAP23 pAb (ATL-HPA019818) | |
| Datasheet | Anti ARHGAP23 pAb (ATL-HPA019818) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP23 pAb (ATL-HPA019818) |
| Citations for Anti ARHGAP23 pAb (ATL-HPA019818) – 1 Found |
| Zhang, Liang; Luga, Valbona; Armitage, Sarah K; Musiol, Martin; Won, Amy; Yip, Christopher M; Plotnikov, Sergey V; Wrana, Jeffrey L. A lateral signalling pathway coordinates shape volatility during cell migration. Nature Communications. 2016;7( 27226243):11714. PubMed |