Anti ARHGAP23 pAb (ATL-HPA019818)

Atlas Antibodies

Catalog No.:
ATL-HPA019818-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 23
Gene Name: ARHGAP23
Alternative Gene Name: KIAA1501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049807: 97%, ENSRNOG00000022771: 94%
Entrez Gene ID: 57636
Uniprot ID: Q9P227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS
Gene Sequence MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS
Gene ID - Mouse ENSMUSG00000049807
Gene ID - Rat ENSRNOG00000022771
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP23 pAb (ATL-HPA019818)
Datasheet Anti ARHGAP23 pAb (ATL-HPA019818) Datasheet (External Link)
Vendor Page Anti ARHGAP23 pAb (ATL-HPA019818) at Atlas Antibodies

Documents & Links for Anti ARHGAP23 pAb (ATL-HPA019818)
Datasheet Anti ARHGAP23 pAb (ATL-HPA019818) Datasheet (External Link)
Vendor Page Anti ARHGAP23 pAb (ATL-HPA019818)
Citations for Anti ARHGAP23 pAb (ATL-HPA019818) – 1 Found
Zhang, Liang; Luga, Valbona; Armitage, Sarah K; Musiol, Martin; Won, Amy; Yip, Christopher M; Plotnikov, Sergey V; Wrana, Jeffrey L. A lateral signalling pathway coordinates shape volatility during cell migration. Nature Communications. 2016;7( 27226243):11714.  PubMed