Anti ARHGAP22 pAb (ATL-HPA040391)

Atlas Antibodies

Catalog No.:
ATL-HPA040391-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 22
Gene Name: ARHGAP22
Alternative Gene Name: RhoGAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063506: 65%, ENSRNOG00000024728: 61%
Entrez Gene ID: 58504
Uniprot ID: Q7Z5H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLR
Gene Sequence PKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLR
Gene ID - Mouse ENSMUSG00000063506
Gene ID - Rat ENSRNOG00000024728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP22 pAb (ATL-HPA040391)
Datasheet Anti ARHGAP22 pAb (ATL-HPA040391) Datasheet (External Link)
Vendor Page Anti ARHGAP22 pAb (ATL-HPA040391) at Atlas Antibodies

Documents & Links for Anti ARHGAP22 pAb (ATL-HPA040391)
Datasheet Anti ARHGAP22 pAb (ATL-HPA040391) Datasheet (External Link)
Vendor Page Anti ARHGAP22 pAb (ATL-HPA040391)