Anti ARHGAP20 pAb (ATL-HPA076303)

Atlas Antibodies

SKU:
ATL-HPA076303-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 20
Gene Name: ARHGAP20
Alternative Gene Name: KIAA1391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053199: 88%, ENSRNOG00000025624: 88%
Entrez Gene ID: 57569
Uniprot ID: Q9P2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Gene Sequence STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Gene ID - Mouse ENSMUSG00000053199
Gene ID - Rat ENSRNOG00000025624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303)
Datasheet Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA076303) at Atlas Antibodies

Documents & Links for Anti ARHGAP20 pAb (ATL-HPA076303)
Datasheet Anti ARHGAP20 pAb (ATL-HPA076303) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA076303)