Anti ARHGAP20 pAb (ATL-HPA038458)

Atlas Antibodies

SKU:
ATL-HPA038458-25
  • Immunohistochemical staining of human cerebral cortex shows granular cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 20
Gene Name: ARHGAP20
Alternative Gene Name: KIAA1391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053199: 77%, ENSRNOG00000025624: 86%
Entrez Gene ID: 57569
Uniprot ID: Q9P2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGPRTHRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVGKSSATNQNTE
Gene Sequence KGPRTHRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVGKSSATNQNTE
Gene ID - Mouse ENSMUSG00000053199
Gene ID - Rat ENSRNOG00000025624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP20 pAb (ATL-HPA038458)
Datasheet Anti ARHGAP20 pAb (ATL-HPA038458) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA038458) at Atlas Antibodies

Documents & Links for Anti ARHGAP20 pAb (ATL-HPA038458)
Datasheet Anti ARHGAP20 pAb (ATL-HPA038458) Datasheet (External Link)
Vendor Page Anti ARHGAP20 pAb (ATL-HPA038458)