Anti ARHGAP20 pAb (ATL-HPA038458)

Atlas Antibodies

Catalog No.: ATL-HPA038458-25

Protein Description: Rho GTPase activating protein 20
Gene Name: ARHGAP20
Alternative Gene Name: KIAA1391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053199: 77%, ENSRNOG00000025624: 86%
Entrez Gene ID: 57569
Uniprot ID: Q9P2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGPRTHRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVGKSSATNQNTE
• Gene Sequence: KGPRTHRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLINQSLVMGIEVGKSSATNQNTE
• Gene ID - Mouse: ENSMUSG00000053199
• Gene ID - Rat: ENSRNOG00000025624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.