Anti ARHGAP19 pAb (ATL-HPA043231)

Atlas Antibodies

SKU:
ATL-HPA043231-100
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 19
Gene Name: ARHGAP19
Alternative Gene Name: FLJ00194, MGC14258
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025154: 94%, ENSRNOG00000048166: 94%
Entrez Gene ID: 84986
Uniprot ID: Q14CB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
Gene Sequence LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
Gene ID - Mouse ENSMUSG00000025154
Gene ID - Rat ENSRNOG00000048166
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP19 pAb (ATL-HPA043231)
Datasheet Anti ARHGAP19 pAb (ATL-HPA043231) Datasheet (External Link)
Vendor Page Anti ARHGAP19 pAb (ATL-HPA043231) at Atlas Antibodies

Documents & Links for Anti ARHGAP19 pAb (ATL-HPA043231)
Datasheet Anti ARHGAP19 pAb (ATL-HPA043231) Datasheet (External Link)
Vendor Page Anti ARHGAP19 pAb (ATL-HPA043231)