Anti ARHGAP19 pAb (ATL-HPA043231)

Atlas Antibodies

Catalog No.: ATL-HPA043231-100

Protein Description: Rho GTPase activating protein 19
Gene Name: ARHGAP19
Alternative Gene Name: FLJ00194, MGC14258
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025154: 94%, ENSRNOG00000048166: 94%
Entrez Gene ID: 84986
Uniprot ID: Q14CB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
• Gene Sequence: LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
• Gene ID - Mouse: ENSMUSG00000025154
• Gene ID - Rat: ENSRNOG00000048166
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.