Anti ARHGAP19 pAb (ATL-HPA035777)

Atlas Antibodies

Catalog No.:
ATL-HPA035777-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 19
Gene Name: ARHGAP19
Alternative Gene Name: FLJ00194, MGC14258
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025154: 82%, ENSRNOG00000048166: 85%
Entrez Gene ID: 84986
Uniprot ID: Q14CB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVTANDLQENITKLNSGMAFMIKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKSQKRNRVDSCPHQEETQHHTEEALREL
Gene Sequence NVTANDLQENITKLNSGMAFMIKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKSQKRNRVDSCPHQEETQHHTEEALREL
Gene ID - Mouse ENSMUSG00000025154
Gene ID - Rat ENSRNOG00000048166
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP19 pAb (ATL-HPA035777)
Datasheet Anti ARHGAP19 pAb (ATL-HPA035777) Datasheet (External Link)
Vendor Page Anti ARHGAP19 pAb (ATL-HPA035777) at Atlas Antibodies

Documents & Links for Anti ARHGAP19 pAb (ATL-HPA035777)
Datasheet Anti ARHGAP19 pAb (ATL-HPA035777) Datasheet (External Link)
Vendor Page Anti ARHGAP19 pAb (ATL-HPA035777)