Anti ARHGAP17 pAb (ATL-HPA041703)

Atlas Antibodies

SKU: ATL-HPA041703-25

• 
• 
• 

Protein Description: Rho GTPase activating protein 17
Gene Name: ARHGAP17
Alternative Gene Name: FLJ10308, FLJ13219, NADRIN, RICH1, WBP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030766: 100%, ENSRNOG00000013836: 100%
Entrez Gene ID: 55114
Uniprot ID: Q68EM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA
• Gene Sequence: KQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEA
• Gene ID - Mouse: ENSMUSG00000030766
• Gene ID - Rat: ENSRNOG00000013836
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.