Anti ARHGAP15 pAb (ATL-HPA032125)

Atlas Antibodies

Catalog No.:
ATL-HPA032125-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 15
Gene Name: ARHGAP15
Alternative Gene Name: BM046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049744: 79%, ENSRNOG00000031168: 74%
Entrez Gene ID: 55843
Uniprot ID: Q53QZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRP
Gene Sequence LPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRP
Gene ID - Mouse ENSMUSG00000049744
Gene ID - Rat ENSRNOG00000031168
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP15 pAb (ATL-HPA032125)
Datasheet Anti ARHGAP15 pAb (ATL-HPA032125) Datasheet (External Link)
Vendor Page Anti ARHGAP15 pAb (ATL-HPA032125) at Atlas Antibodies

Documents & Links for Anti ARHGAP15 pAb (ATL-HPA032125)
Datasheet Anti ARHGAP15 pAb (ATL-HPA032125) Datasheet (External Link)
Vendor Page Anti ARHGAP15 pAb (ATL-HPA032125)