Anti ARHGAP12 pAb (ATL-HPA000412 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA000412-25

• 
• 

Protein Description: Rho GTPase activating protein 12
Gene Name: ARHGAP12
Alternative Gene Name: FLJ10971, FLJ20737, FLJ21785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041225: 86%, ENSRNOG00000017791: 86%
Entrez Gene ID: 94134
Uniprot ID: Q8IWW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP
• Gene Sequence: RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP
• Gene ID - Mouse: ENSMUSG00000041225
• Gene ID - Rat: ENSRNOG00000017791
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGAP12 pAb (ATL-HPA000412 w/enhanced validation) – 2 Found

Schlam, Daniel; Bagshaw, Richard D; Freeman, Spencer A; Collins, Richard F; Pawson, Tony; Fairn, Gregory D; Grinstein, Sergio. Phosphoinositide 3-kinase enables phagocytosis of large particles by terminating actin assembly through Rac/Cdc42 GTPase-activating proteins. Nature Communications. 2015;6( 26465210):8623. 

Diring, Jessica; Mouilleron, Stephane; McDonald, Neil Q; Treisman, Richard. RPEL-family rhoGAPs link Rac/Cdc42 GTP loading to G-actin availability. Nature Cell Biology. 2019;21(7):845-855.