Anti ARHGAP11A pAb (ATL-HPA040830)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040830-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARHGAP11A
Alternative Gene Name: KIAA0013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041219: 79%, ENSRNOG00000008115: 80%
Entrez Gene ID: 9824
Uniprot ID: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVESGKAGCFSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTGLLFSPDVDEKLPKKGSE |
Gene Sequence | RVESGKAGCFSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTGLLFSPDVDEKLPKKGSE |
Gene ID - Mouse | ENSMUSG00000041219 |
Gene ID - Rat | ENSRNOG00000008115 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARHGAP11A pAb (ATL-HPA040830) | |
Datasheet | Anti ARHGAP11A pAb (ATL-HPA040830) Datasheet (External Link) |
Vendor Page | Anti ARHGAP11A pAb (ATL-HPA040830) at Atlas Antibodies |
Documents & Links for Anti ARHGAP11A pAb (ATL-HPA040830) | |
Datasheet | Anti ARHGAP11A pAb (ATL-HPA040830) Datasheet (External Link) |
Vendor Page | Anti ARHGAP11A pAb (ATL-HPA040830) |
Citations for Anti ARHGAP11A pAb (ATL-HPA040830) – 1 Found |
Ly, Tony; Ahmad, Yasmeen; Shlien, Adam; Soroka, Dominique; Mills, Allie; Emanuele, Michael J; Stratton, Michael R; Lamond, Angus I. A proteomic chronology of gene expression through the cell cycle in human myeloid leukemia cells. Elife. 2014;3( 24596151):e01630. PubMed |