Anti ARHGAP11A pAb (ATL-HPA040830)

Atlas Antibodies

Catalog No.:
ATL-HPA040830-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 11A
Gene Name: ARHGAP11A
Alternative Gene Name: KIAA0013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041219: 79%, ENSRNOG00000008115: 80%
Entrez Gene ID: 9824
Uniprot ID: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVESGKAGCFSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTGLLFSPDVDEKLPKKGSE
Gene Sequence RVESGKAGCFSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTGLLFSPDVDEKLPKKGSE
Gene ID - Mouse ENSMUSG00000041219
Gene ID - Rat ENSRNOG00000008115
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP11A pAb (ATL-HPA040830)
Datasheet Anti ARHGAP11A pAb (ATL-HPA040830) Datasheet (External Link)
Vendor Page Anti ARHGAP11A pAb (ATL-HPA040830) at Atlas Antibodies

Documents & Links for Anti ARHGAP11A pAb (ATL-HPA040830)
Datasheet Anti ARHGAP11A pAb (ATL-HPA040830) Datasheet (External Link)
Vendor Page Anti ARHGAP11A pAb (ATL-HPA040830)
Citations for Anti ARHGAP11A pAb (ATL-HPA040830) – 1 Found
Ly, Tony; Ahmad, Yasmeen; Shlien, Adam; Soroka, Dominique; Mills, Allie; Emanuele, Michael J; Stratton, Michael R; Lamond, Angus I. A proteomic chronology of gene expression through the cell cycle in human myeloid leukemia cells. Elife. 2014;3( 24596151):e01630.  PubMed