Anti ARHGAP11A pAb (ATL-HPA040419)

Atlas Antibodies

Catalog No.: ATL-HPA040419-25

Protein Description: Rho GTPase activating protein 11A
Gene Name: ARHGAP11A
Alternative Gene Name: KIAA0013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041219: 81%, ENSRNOG00000008115: 81%
Entrez Gene ID: 9824
Uniprot ID: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRT
• Gene Sequence: DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRT
• Gene ID - Mouse: ENSMUSG00000041219
• Gene ID - Rat: ENSRNOG00000008115
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARHGAP11A pAb (ATL-HPA040419) – 1 Found

Ly, Tony; Ahmad, Yasmeen; Shlien, Adam; Soroka, Dominique; Mills, Allie; Emanuele, Michael J; Stratton, Michael R; Lamond, Angus I. A proteomic chronology of gene expression through the cell cycle in human myeloid leukemia cells. Elife. 2014;3( 24596151):e01630.