Anti ARHGAP11A pAb (ATL-HPA040419)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040419-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARHGAP11A
Alternative Gene Name: KIAA0013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041219: 81%, ENSRNOG00000008115: 81%
Entrez Gene ID: 9824
Uniprot ID: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRT |
| Gene Sequence | DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRT |
| Gene ID - Mouse | ENSMUSG00000041219 |
| Gene ID - Rat | ENSRNOG00000008115 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGAP11A pAb (ATL-HPA040419) | |
| Datasheet | Anti ARHGAP11A pAb (ATL-HPA040419) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP11A pAb (ATL-HPA040419) at Atlas Antibodies |
| Documents & Links for Anti ARHGAP11A pAb (ATL-HPA040419) | |
| Datasheet | Anti ARHGAP11A pAb (ATL-HPA040419) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP11A pAb (ATL-HPA040419) |
| Citations for Anti ARHGAP11A pAb (ATL-HPA040419) – 1 Found |
| Ly, Tony; Ahmad, Yasmeen; Shlien, Adam; Soroka, Dominique; Mills, Allie; Emanuele, Michael J; Stratton, Michael R; Lamond, Angus I. A proteomic chronology of gene expression through the cell cycle in human myeloid leukemia cells. Elife. 2014;3( 24596151):e01630. PubMed |