Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004689-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: ARHGAP1
Alternative Gene Name: CDC42GAP, p50rhoGAP, RhoGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027247: 98%, ENSRNOG00000016610: 98%
Entrez Gene ID: 392
Uniprot ID: Q07960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS |
| Gene Sequence | SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS |
| Gene ID - Mouse | ENSMUSG00000027247 |
| Gene ID - Rat | ENSRNOG00000016610 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) | |
| Datasheet | Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) | |
| Datasheet | Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) |
| Citations for Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) – 1 Found |
| Härmä, V; Knuuttila, M; Virtanen, J; Mirtti, T; Kohonen, P; Kovanen, P; Happonen, A; Kaewphan, S; Ahonen, I; Kallioniemi, O; Grafström, R; Lötjönen, J; Nees, M. Lysophosphatidic acid and sphingosine-1-phosphate promote morphogenesis and block invasion of prostate cancer cells in three-dimensional organotypic models. Oncogene. 2012;31(16):2075-89. PubMed |