Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004689-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 1
Gene Name: ARHGAP1
Alternative Gene Name: CDC42GAP, p50rhoGAP, RhoGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027247: 98%, ENSRNOG00000016610: 98%
Entrez Gene ID: 392
Uniprot ID: Q07960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS
Gene Sequence SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS
Gene ID - Mouse ENSMUSG00000027247
Gene ID - Rat ENSRNOG00000016610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation)
Datasheet Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation)
Datasheet Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation)
Citations for Anti ARHGAP1 pAb (ATL-HPA004689 w/enhanced validation) – 1 Found
Härmä, V; Knuuttila, M; Virtanen, J; Mirtti, T; Kohonen, P; Kovanen, P; Happonen, A; Kaewphan, S; Ahonen, I; Kallioniemi, O; Grafström, R; Lötjönen, J; Nees, M. Lysophosphatidic acid and sphingosine-1-phosphate promote morphogenesis and block invasion of prostate cancer cells in three-dimensional organotypic models. Oncogene. 2012;31(16):2075-89.  PubMed