Anti ARGLU1 pAb (ATL-HPA056792)

Atlas Antibodies

Catalog No.:
ATL-HPA056792-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: arginine and glutamate rich 1
Gene Name: ARGLU1
Alternative Gene Name: FLJ10154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040459: 91%, ENSRNOG00000024142: 91%
Entrez Gene ID: 55082
Uniprot ID: Q9NWB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR
Gene Sequence RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR
Gene ID - Mouse ENSMUSG00000040459
Gene ID - Rat ENSRNOG00000024142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARGLU1 pAb (ATL-HPA056792)
Datasheet Anti ARGLU1 pAb (ATL-HPA056792) Datasheet (External Link)
Vendor Page Anti ARGLU1 pAb (ATL-HPA056792) at Atlas Antibodies

Documents & Links for Anti ARGLU1 pAb (ATL-HPA056792)
Datasheet Anti ARGLU1 pAb (ATL-HPA056792) Datasheet (External Link)
Vendor Page Anti ARGLU1 pAb (ATL-HPA056792)