Anti ARGLU1 pAb (ATL-HPA056792)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056792-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARGLU1
Alternative Gene Name: FLJ10154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040459: 91%, ENSRNOG00000024142: 91%
Entrez Gene ID: 55082
Uniprot ID: Q9NWB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR |
| Gene Sequence | RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR |
| Gene ID - Mouse | ENSMUSG00000040459 |
| Gene ID - Rat | ENSRNOG00000024142 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARGLU1 pAb (ATL-HPA056792) | |
| Datasheet | Anti ARGLU1 pAb (ATL-HPA056792) Datasheet (External Link) |
| Vendor Page | Anti ARGLU1 pAb (ATL-HPA056792) at Atlas Antibodies |
| Documents & Links for Anti ARGLU1 pAb (ATL-HPA056792) | |
| Datasheet | Anti ARGLU1 pAb (ATL-HPA056792) Datasheet (External Link) |
| Vendor Page | Anti ARGLU1 pAb (ATL-HPA056792) |