Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000663-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: arginase 2
Gene Name: ARG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021125: 80%, ENSRNOG00000053811: 81%
Entrez Gene ID: 384
Uniprot ID: P78540
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHAD
Gene Sequence MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHAD
Gene ID - Mouse ENSMUSG00000021125
Gene ID - Rat ENSRNOG00000053811
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation)
Datasheet Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation)
Datasheet Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation)
Citations for Anti ARG2 pAb (ATL-HPA000663 w/enhanced validation) – 3 Found
Grönros, Julia; Jung, Christian; Lundberg, Jon O; Cerrato, Ruha; Ostenson, Claes-Göran; Pernow, John. Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats. American Journal Of Physiology. Heart And Circulatory Physiology. 2011;300(4):H1174-81.  PubMed
Gonon, Adrian T; Jung, Christian; Katz, Abram; Westerblad, Håkan; Shemyakin, Alexey; Sjöquist, Per-Ove; Lundberg, Jon O; Pernow, John. Local arginase inhibition during early reperfusion mediates cardioprotection via increased nitric oxide production. Plos One. 7(7):e42038.  PubMed
Shemyakin, Alexey; Kövamees, Oskar; Rafnsson, Arnar; Böhm, Felix; Svenarud, Peter; Settergren, Magnus; Jung, Christian; Pernow, John. Arginase inhibition improves endothelial function in patients with coronary artery disease and type 2 diabetes mellitus. Circulation. 2012;126(25):2943-50.  PubMed