Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024006-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: arginase 1
Gene Name: ARG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019987: 91%, ENSRNOG00000013304: 94%
Entrez Gene ID: 383
Uniprot ID: P05089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITL
Gene Sequence GLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITL
Gene ID - Mouse ENSMUSG00000019987
Gene ID - Rat ENSRNOG00000013304
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation)
Datasheet Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation)
Datasheet Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation)
Citations for Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) – 4 Found
de Boniface, Jana; Mao, Yumeng; Schmidt-Mende, Jan; Kiessling, Rolf; Poschke, Isabel. Expression patterns of the immunomodulatory enzyme arginase 1 in blood, lymph nodes and tumor tissue of early-stage breast cancer patients. Oncoimmunology. 2012;1(8):1305-1312.  PubMed
Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22.  PubMed
Hashimoto-Kataoka, Takahiro; Hosen, Naoki; Sonobe, Takashi; Arita, Yoh; Yasui, Taku; Masaki, Takeshi; Minami, Masato; Inagaki, Tadakatsu; Miyagawa, Shigeru; Sawa, Yoshiki; Murakami, Masaaki; Kumanogoh, Atsushi; Yamauchi-Takihara, Keiko; Okumura, Meinoshin; Kishimoto, Tadamitsu; Komuro, Issei; Shirai, Mikiyasu; Sakata, Yasushi; Nakaoka, Yoshikazu. Interleukin-6/interleukin-21 signaling axis is critical in the pathogenesis of pulmonary arterial hypertension. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(20):E2677-86.  PubMed
Wang, Xiangdong; Xiang, Huihui; Toyoshima, Yujiro; Shen, Weidong; Shichi, Shunsuke; Nakamoto, Hiroki; Kimura, Saori; Sugiyama, Ko; Homma, Shigenori; Miyagi, Yohei; Taketomi, Akinobu; Kitamura, Hidemitsu. Arginase-1 inhibition reduces migration ability and metastatic colonization of colon cancer cells. Cancer & Metabolism. 2023;11(1):1.  PubMed