Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024006-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ARG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019987: 91%, ENSRNOG00000013304: 94%
Entrez Gene ID: 383
Uniprot ID: P05089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITL |
| Gene Sequence | GLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITL |
| Gene ID - Mouse | ENSMUSG00000019987 |
| Gene ID - Rat | ENSRNOG00000013304 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) | |
| Datasheet | Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) | |
| Datasheet | Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) |
| Citations for Anti ARG1 pAb (ATL-HPA024006 w/enhanced validation) – 4 Found |
| de Boniface, Jana; Mao, Yumeng; Schmidt-Mende, Jan; Kiessling, Rolf; Poschke, Isabel. Expression patterns of the immunomodulatory enzyme arginase 1 in blood, lymph nodes and tumor tissue of early-stage breast cancer patients. Oncoimmunology. 2012;1(8):1305-1312. PubMed |
| Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. PubMed |
| Hashimoto-Kataoka, Takahiro; Hosen, Naoki; Sonobe, Takashi; Arita, Yoh; Yasui, Taku; Masaki, Takeshi; Minami, Masato; Inagaki, Tadakatsu; Miyagawa, Shigeru; Sawa, Yoshiki; Murakami, Masaaki; Kumanogoh, Atsushi; Yamauchi-Takihara, Keiko; Okumura, Meinoshin; Kishimoto, Tadamitsu; Komuro, Issei; Shirai, Mikiyasu; Sakata, Yasushi; Nakaoka, Yoshikazu. Interleukin-6/interleukin-21 signaling axis is critical in the pathogenesis of pulmonary arterial hypertension. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(20):E2677-86. PubMed |
| Wang, Xiangdong; Xiang, Huihui; Toyoshima, Yujiro; Shen, Weidong; Shichi, Shunsuke; Nakamoto, Hiroki; Kimura, Saori; Sugiyama, Ko; Homma, Shigenori; Miyagi, Yohei; Taketomi, Akinobu; Kitamura, Hidemitsu. Arginase-1 inhibition reduces migration ability and metastatic colonization of colon cancer cells. Cancer & Metabolism. 2023;11(1):1. PubMed |