Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003595-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: arginase 1
Gene Name: ARG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019987: 82%, ENSRNOG00000013304: 81%
Entrez Gene ID: 383
Uniprot ID: P05089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA
Gene Sequence TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA
Gene ID - Mouse ENSMUSG00000019987
Gene ID - Rat ENSRNOG00000013304
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation)
Datasheet Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation)
Datasheet Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation)
Citations for Anti ARG1 pAb (ATL-HPA003595 w/enhanced validation) – 15 Found
Romano, Alessandra; Parrinello, Nunziatina Laura; Vetro, Calogero; Tibullo, Daniele; Giallongo, Cesarina; La Cava, Piera; Chiarenza, Annalisa; Motta, Giovanna; Caruso, Anastasia L; Villari, Loredana; Tripodo, Claudio; Cosentino, Sebastiano; Ippolito, Massimo; Consoli, Ugo; Gallamini, Andrea; Pileri, Stefano; Di Raimondo, Francesco. The prognostic value of the myeloid-mediated immunosuppression marker Arginase-1 in classic Hodgkin lymphoma. Oncotarget. 2016;7(41):67333-67346.  PubMed
Puglisi, Fabrizio; Parrinello, Nunziatina Laura; Giallongo, Cesarina; Cambria, Daniela; Camiolo, Giuseppina; Bellofiore, Claudia; Conticello, Concetta; Del Fabro, Vittorio; Leotta, Valerio; Markovic, Uros; Sapienza, Giuseppe; Barbato, Alessandro; Scalese, Silvia; Tibullo, Daniele; Brundo, Maria Violetta; Palumbo, Giuseppe Alberto; Di Raimondo, Francesco; Romano, Alessandra. Plasticity of High-Density Neutrophils in Multiple Myeloma is Associated with Increased Autophagy Via STAT3. International Journal Of Molecular Sciences. 2019;20(14)  PubMed
Chaerkady, Raghothama; Harsha, H C; Nalli, Anuradha; Gucek, Marjan; Vivekanandan, Perumal; Akhtar, Javed; Cole, Robert N; Simmers, Jessica; Schulick, Richard D; Singh, Sujay; Torbenson, Michael; Pandey, Akhilesh; Thuluvath, Paul J. A quantitative proteomic approach for identification of potential biomarkers in hepatocellular carcinoma. Journal Of Proteome Research. 2008;7(10):4289-98.  PubMed
Yan, Benjamin C; Gong, Can; Song, Jie; Krausz, Thomas; Tretiakova, Maria; Hyjek, Elizabeth; Al-Ahmadie, Hikmat; Alves, Venancio; Xiao, Shu-Yuan; Anders, Robert A; Hart, John A. Arginase-1: a new immunohistochemical marker of hepatocytes and hepatocellular neoplasms. The American Journal Of Surgical Pathology. 2010;34(8):1147-54.  PubMed
Grönros, Julia; Jung, Christian; Lundberg, Jon O; Cerrato, Ruha; Ostenson, Claes-Göran; Pernow, John. Arginase inhibition restores in vivo coronary microvascular function in type 2 diabetic rats. American Journal Of Physiology. Heart And Circulatory Physiology. 2011;300(4):H1174-81.  PubMed
Gonon, Adrian T; Jung, Christian; Katz, Abram; Westerblad, Håkan; Shemyakin, Alexey; Sjöquist, Per-Ove; Lundberg, Jon O; Pernow, John. Local arginase inhibition during early reperfusion mediates cardioprotection via increased nitric oxide production. Plos One. 7(7):e42038.  PubMed
Shemyakin, Alexey; Kövamees, Oskar; Rafnsson, Arnar; Böhm, Felix; Svenarud, Peter; Settergren, Magnus; Jung, Christian; Pernow, John. Arginase inhibition improves endothelial function in patients with coronary artery disease and type 2 diabetes mellitus. Circulation. 2012;126(25):2943-50.  PubMed
Yang, Jiangning; Gonon, Adrian T; Sjöquist, Per-Ove; Lundberg, Jon O; Pernow, John. Arginase regulates red blood cell nitric oxide synthase and export of cardioprotective nitric oxide bioactivity. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2013;110(37):15049-54.  PubMed
Romano, A; Parrinello, N L; Simeon, V; Puglisi, F; La Cava, P; Bellofiore, C; Giallongo, C; Camiolo, G; D'Auria, F; Grieco, V; Larocca, F; Barbato, A; Cambria, D; La Spina, E; Tibullo, D; Palumbo, G A; Conticello, C; Musto, P; Di Raimondo, F. High-density neutrophils in MGUS and multiple myeloma are dysfunctional and immune-suppressive due to increased STAT3 downstream signaling. Scientific Reports. 2020;10(1):1983.  PubMed
Venè, Roberta; Costa, Delfina; Augugliaro, Raffaella; Carlone, Sebastiano; Scabini, Stefano; Casoni Pattacini, Gianmaria; Boggio, Maurizio; Zupo, Simonetta; Grillo, Federica; Mastracci, Luca; Pitto, Francesca; Minghelli, Simona; Ferrari, Nicoletta; Tosetti, Francesca; Romairone, Emanuele; Mingari, Maria C; Poggi, Alessandro; Benelli, Roberto. Evaluation of Glycosylated PTGS2 in Colorectal Cancer for NSAIDS-Based Adjuvant Therapy. Cells. 2020;9(3)  PubMed
Barboza, Tania Cristina; Sotto, Mirian Nacagami; Kanashiro-Galo, Luciane; de Brito, Arival Cardoso; Duarte, Maria Irma Seixas; Quaresma, Juarez Antonio Simões; Pagliari, Carla. M2-Polarized Macrophages Determine Human Cutaneous Lesions in Lacaziosis. Mycopathologia. 2020;185(3):477-483.  PubMed
Iwaya, Mai; Riddell, Robert; Asano, Koji; Kobayashi, Kazuo; Uehara, Takeshi; Ota, Hiroyoshi. Alpha-Fetoprotein-Producing Early Gastric Cancer with Intramucosal Hepatoid and Fetal Enteric Differentiation. Case Reports In Gastroenterology. 2020;14(2):426-435.  PubMed
Vacas, Andrés; Fernández-Rubio, Celia; Larrea, Esther; Peña-Guerrero, José; Nguewa, Paul A. LmjF.22.0810 from Leishmania major Modulates the Th2-Type Immune Response and Is Involved in Leishmaniasis Outcome. Biomedicines. 2020;8(11)  PubMed
Wang, Congrong; Shao, Xiangyang; Zhang, Xuanyu; Xie, Chunmei; Yu, Juanping; Xu, Xiao; Yang, Jian; Li, Yu; Xu, Weiwen. Diagnostic value of glypican-3, arginase-1 and hepatocyte paraffin antigen -1 in differentiating hepatocellular carcinoma from intrahepatic cholangiocarcinoma. Translational Cancer Research. 2020;9(1):128-136.  PubMed
Argani, Pedram; Palsgrove, Doreen N; Anders, Robert A; Smith, Steven C; Saoud, Carla; Kwon, Regina; Voltaggio, Lysandra; Assarzadegan, Naziheh; Oshima, Kiyoko; Rooper, Lisa; Matoso, Andres; Zhang, Lei; Cantarel, Brandi L; Gagan, Jeffrey; Antonescu, Cristina R. A Novel NIPBL-NACC1 Gene Fusion Is Characteristic of the Cholangioblastic Variant of Intrahepatic Cholangiocarcinoma. The American Journal Of Surgical Pathology. 2021;45(11):1550-1560.  PubMed