Anti ARFRP1 pAb (ATL-HPA050634)

Atlas Antibodies

Catalog No.:
ATL-HPA050634-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor related protein 1
Gene Name: ARFRP1
Alternative Gene Name: ARL18, ARP, Arp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038671: 97%, ENSRNOG00000013992: 97%
Entrez Gene ID: 10139
Uniprot ID: Q13795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSE
Gene Sequence QSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSE
Gene ID - Mouse ENSMUSG00000038671
Gene ID - Rat ENSRNOG00000013992
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARFRP1 pAb (ATL-HPA050634)
Datasheet Anti ARFRP1 pAb (ATL-HPA050634) Datasheet (External Link)
Vendor Page Anti ARFRP1 pAb (ATL-HPA050634) at Atlas Antibodies

Documents & Links for Anti ARFRP1 pAb (ATL-HPA050634)
Datasheet Anti ARFRP1 pAb (ATL-HPA050634) Datasheet (External Link)
Vendor Page Anti ARFRP1 pAb (ATL-HPA050634)